KEGG   Treponema succinifaciens: Tresu_1583Help
Entry
Tresu_1583        CDS       T01461                                 

Definition
(GenBank) Butyrate--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
tsu  Treponema succinifaciens
Pathway
tsu00010  Glycolysis / Gluconeogenesis
tsu00620  Pyruvate metabolism
tsu00640  Propanoate metabolism
tsu00680  Methane metabolism
tsu01100  Metabolic pathways
tsu01110  Biosynthesis of secondary metabolites
tsu01120  Microbial metabolism in diverse environments
tsu01130  Biosynthesis of antibiotics
tsu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tsu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tresu_1583
   00620 Pyruvate metabolism
    Tresu_1583
   00640 Propanoate metabolism
    Tresu_1583
  Energy metabolism
   00680 Methane metabolism
    Tresu_1583
Enzymes [BR:tsu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Tresu_1583
Lipid biosynthesis proteins [BR:tsu01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Tresu_1583
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AEB14483
UniProt: F2NVP6
Position
complement(1719988..1721682)
Genome map
AA seq 564 aa AA seqDB search
MALYHDFLVEDREFTSYEDLKAHCRLKAPENFNFAYDIVDRYTVTEPGKRALVWCDDDGE
EHTWTFEQISADSKRTAYFLASQGIKKGDAVMMILRRRYEWWWVMMALHRIGAIAVPATD
QLLQKDIEYRTNAAEIKMIISYDNPAVQSEIEKALPNSPTVKKLVTVGPSREGWIDFHAE
VDKCVPEFPRPVGDAAVHSEDPMLLYFTSGTSGYPKMVLHNYLYPIGHLITAKYWHGVQD
NGLHLAVSETGWGKAVWGKLYGQWICGSAVFVYDMHSFKPDKMLQKIAKYGITTFCAPPT
VYRYLIRQDLSKYDISSVVRFATAGEALNGEVYNKFIEQTGKKIYEGYGQTESTIICGNF
LDAVVRPGSMGRPSPVYDVSVVNASGKPVPAGEVGELVIHLDKGHPFGLLSGYYRDVALT
ANAFDGGVYHTGDTVYMDEDGYVWFVGRKDDIIKSSGFRISPFEVESVLQQHPAVMECAV
TGVPDEKRGQAVKATIVLSPGYEASEELEHELFDFVKHETALFKCPRIIEFVHELPKTIS
GKIRRVEIREKDAGVDVDKVKQEF
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atggcactttatcatgattttttagttgaagacagagagtttacttcctacgaggacttg
aaggcgcattgccgcttgaaggctccggaaaatttcaattttgcctatgacattgtagac
cgctacactgttacagagcctggaaaaagagcccttgtgtggtgcgatgacgacggtgaa
gaacatacttggacatttgagcagatttcagctgattcaaagcggactgcatattttctt
gcttcacagggaataaaaaaaggcgatgccgttatgatgattttgcgccgccgctacgaa
tggtggtgggtaatgatggctcttcatagaatcggagcaatcgcagttccggctacagat
cagttgcttcaaaaagacattgagtaccgcacaaatgccgctgaaatcaagatgattatt
tcttacgacaatccggctgttcagtctgaaattgaaaaggctcttccgaattccccgact
gtaaaaaaacttgttactgtcggaccttcacgcgaaggctggattgacttccatgctgaa
gttgacaagtgcgttccggaatttccgcgcccggtaggagatgccgccgtccacagtgaa
gatccgatgcttctttactttacgtcaggaacttcaggctatccaaagatggttctgcac
aattatctttatccgatcggacatcttataactgcaaaatactggcacggtgttcaggac
aacggtcttcatcttgctgtctctgaaactggctggggaaaagctgtctggggaaagctc
tacggtcagtggatctgcggaagcgcggtttttgtttacgatatgcatagtttcaagccg
gacaagatgctccagaaaatcgcaaagtacggaattacaactttctgtgcgcctccaact
gtttaccgctatcttatcaggcaggacctttcaaagtacgacatcagcagcgtagtgcgt
tttgcgactgcgggagaagctctcaacggcgaagtctacaacaagtttatagagcagaca
ggaaagaaaatctatgaaggctacggtcagactgaatccacgattatctgcggaaacttc
cttgacgctgttgttcgtcctggctcaatgggtcgtccgtctcctgtttatgacgtttct
gttgtaaatgccagtggaaagccggttcctgcaggtgaagtaggtgagcttgtaatccac
ttggacaaaggacatccgttcggacttctttctggatactaccgcgatgttgcccttacc
gcgaatgcttttgacggaggtgtttaccatacgggagacactgtctatatggatgaggat
ggatacgtttggttcgttggaagaaaagacgacataattaagtcttctggattcagaatc
agtccgtttgaagttgagtctgttcttcagcagcatccggctgtaatggaatgcgctgtt
acaggcgttcctgatgaaaaaagaggacaggctgtaaaggctacaatcgttctttctccg
ggatacgaggcttccgaagagcttgagcatgagctttttgactttgtaaagcacgagact
gcgcttttcaagtgtcctagaataattgagtttgtgcacgagcttccaaagacaatcagc
ggaaaaatccgccgtgtggaaatccgcgaaaaggatgccggtgtagacgtggacaaggtt
aagcaggaattctaa

DBGET integrated database retrieval system