KEGG   Thermus thermophilus JL-18: TtJL18_1802Help
Entry
TtJL18_1802       CDS       T02009                                 

Definition
UDP-N-acetylmuramyl tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
ttl  Thermus thermophilus JL-18
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:ttl00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    TtJL18_1802
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    TtJL18_1802
Enzymes [BR:ttl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     TtJL18_1802
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1675908..1677356
Genome map
AA seq 482 aa AA seqDB search
MPTLKELFALFGKEAPEVPVRGLTLDSRRVEPGFVFVAVPGVPLPHRKPLDGHDFVPEAL
ARGAVAVVGERPLALPVPYLQVADGRQALALLARRFHGEPDRELLLVGVTGSKGKSTTAS
LLHHLLKRAQGGSALLSTVGLRLGEEARPPVGHFTTPEAPEVYAFLREAADRGLKSAVLE
VSSHALALKRVEGLTFRVGVFVNFYPDDHLDFHGTAEAYFRAKALLVERSDLAVLARSLP
HFPRLAQRPHLSFGEGGEVYAEGLRETPEGLAFRLHTPWGSGEAFLPLLGAYNLENALAA
SAAALALGVGLEAVLEGLATFPGVPGRMEVVLKAPFRVVIDFAHTGKSLEAALKTLRPTT
PGRLLLVVGAAGERDPQRRVDIGRVAARLADKTFFTEEDHRGEDLFAILEAMAQAARAEG
GVYELVPDREEAILKAILEARPGDTVLLAGKGHEATLERGQVALPWNEREAALKALRARG
LP
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgcccaccttgaaggagctcttcgccctcttcgggaaggaagccccggaggtgcccgtc
aggggcctcaccctggactcgaggcgggtggagcccggcttcgtcttcgtggccgtaccc
ggggttcccctcccccaccggaagcccctggacgggcacgacttcgtccccgaggccctg
gcccggggggcggtggccgtggtgggggaaaggcccctcgccctccccgtcccctacctc
caggtggccgacggccgccaggccctcgccctcctggcccggcgcttccacggggagccg
gaccgggagctcctcctcgtgggggtcacggggtccaagggcaagagcaccacggcaagc
ctcctccaccacctcctaaagcgggcccagggcggaagcgccctcctctccaccgtgggc
ctccgcctgggcgaggaggcccgcccccccgtgggccacttcaccaccccggaggccccc
gaggtctacgccttcctccgggaggcggcggaccgcggcctgaaaagcgccgtgctggag
gtctccagccacgccctggccctgaagcgggtggagggcctcaccttccgggtgggggtc
ttcgtgaacttctatcccgacgaccacctggacttccacggcaccgccgaggcctacttc
cgggccaaggccctcctggtggagcggtcggacctcgccgtcctcgcccgtagcctcccc
cacttcccccggctcgcccaaaggcctcacctgagcttcggggagggaggggaggtctat
gcggaggggcttcgggaaaccccggagggcctggccttccgcctccacaccccctggggg
tcaggggaggccttcttgcccctcctcggggcctacaacctggaaaacgccctcgccgca
agcgccgccgccctggccctgggggtgggcctcgaggcggtgctggagggcctcgccacc
ttccccggggtgccgggccggatggaggtggtcctcaaggcccccttccgcgtggtcatt
gacttcgcccacaccgggaagagcctggaggccgccctgaagaccctccgccccaccacc
ccggggaggctccttttggtggtgggggcggccggggagcgggacccccagcggcgcgtg
gacatcggccgggtggcggcccgcctcgcggacaagaccttcttcaccgaggaggaccac
cggggcgaggacctcttcgccatcctggaggccatggcccaggcggcccgggccgagggc
ggggtctacgagctcgtccccgaccgggaggaggccatcctcaaggccatcctcgaggcc
cgccccggggacacggtcctgctcgccggcaagggacacgaggccaccttggagcggggc
caggtggccctgccctggaacgagcgggaggccgccctcaaagccctccgggcgcggggg
cttccctga

DBGET integrated database retrieval system