KEGG   Thermoproteus tenax: TTX_0296Help
Entry
TTX_0296          CDS       T01641                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta-subunit
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ttn  Thermoproteus tenax
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ttn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TTX_0296 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TTX_0296 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TTX_0296 (trpB)
Enzymes [BR:ttn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     TTX_0296 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(281212..282504)
Genome map
AA seq 430 aa AA seqDB search
MEKLRVDLRPEEIPEYWYNIQADLPEPLPPPIDPEGGRRLELLKQVIPSEPLRLETSTER
YIKIPEEVRERYLQVGRPTPLIRARRLEEYLDAPVRIYLKMEGYTYTGSHKINSALAWVY
YALKDGAKFVTTETGAGQWGSAVSLAAALFKVKAHVFMVRASYYAKPLRRFLMQMYGAEV
HPSPSDLTEYGRRLLSERPDHPGSLGVAITEAAEYAARHGGKYVVGSVINTDIMFKTVAG
LEAKKQLELIGEDPDVMIGVVGGGSNWGGAFYPFIGEELRSGKVRRRYIAVGALEVPKVT
KGVYKYDDPDSGRLLPQLKMYTIGADFVPPPIYAGGLRYHGVAPSLSYLMYKGYVEGRDY
DQETVFRMAQLFAQLEGYVPAPETAHVLPAIKEVADEAKRTGERKVILVSFSGHGLLDLA
NFADVLGFGK
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atggagaagttgagggtagatctaaggcctgaggagatccccgagtattggtacaatata
caagcggatctgccggagccgctcccgccgcccatagacccagagggcggcagaaggctg
gagctcctgaaacaggtgatcccctcggagcctctgcggctcgagaccagcaccgagagg
tacatcaagatccccgaggaggtaagagagaggtatctacaagtgggcaggcccacgccg
cttataagggcgaggaggctcgaggaatatttggacgcccccgttaggatatacctaaag
atggagggctatacatacacggggagccacaagataaactcggcgctggcgtgggtctac
tacgctctgaaggacggagccaagtttgtgacaacggagacaggcgccgggcagtggggc
tcggctgtgtctctggctgcggcgctctttaaagtcaaggcccacgtgttcatggtgcgg
gcctcctattacgccaagcccctcaggaggttcttgatgcagatgtacggcgctgaggtg
cacccgagccccagcgaccttacggaatacggcagaaggcttctgtcggagaggccggac
cacccgggctccctcggcgtcgccataacggaggccgctgaatacgccgcaagacacggg
gggaagtacgtagtcggcagcgtcataaacacagacataatgttcaagactgtcgcgggc
cttgaggcgaagaagcagttggagctgatcggagaggaccccgacgtcatgataggcgtg
gtcggaggagggtccaattggggcggggccttctatccgtttataggcgaggagctgagg
tcgggcaaagtcaggaggaggtatatagccgtaggagccctcgaggtgcccaaggtgacc
aagggcgtctataagtacgacgacccggactccgggcgcctgctgccccaactcaagatg
tacactataggcgcagacttcgtgcctccgcccatctatgccggcggcttgaggtaccac
ggggtggcgccatcgctctcctacctaatgtacaagggctacgtcgaggggagggactac
gaccaagagactgtgttccggatggcccagctgttcgcccagctggagggctacgtgccc
gcgcctgagactgcgcacgtgttgccggccataaaggaggtcgcggacgaggccaagagg
acaggcgagaggaaggtgatattggtgagcttcagcggccacgggctcctagatctggcc
aacttcgccgacgtcctcggctttggaaaatag

DBGET integrated database retrieval system