KEGG   Thermoproteus tenax: TTX_1442Help
Entry
TTX_1442          CDS       T01641                                 

Gene name
hat
Definition
Histone acetyltransferase (EC:2.3.1.48)
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
ttn  Thermoproteus tenax
Brite
Enzymes [BR:ttn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     TTX_1442 (hat)
Transfer RNA biogenesis [BR:ttn03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    TTX_1442 (hat)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1269612..1271048
Genome map
AA seq 478 aa AA seqDB search
MIRRPKPEDDGAEVSPIKRPVRAASGVHVVAVMTGPLSCPGECVFCPTARGVPKSYLPDS
PAVLRALRARYDPYRQVMARIKNYLAGGHEPNKIEVIVMGGTFTALPRQYQFWFVGNVLK
ALNDYPQWSSAAPSVDVELEQERNEGATLRLVALTVETRPDYVEKRHIDDLLSLGVTRVE
LGVQSIYDDVLRLTKRGHGVKEVVDATARLKDAAYKVCYHLMPGLPGSDPDRDLDMFRAV
FEDPSFRPDCVKIYPTFVVPGTELYEWWRRGIYRSYDEETWRELLAKIYALVPPWVRVMR
LGRDIPLHHVVDGPRWGNMREVVEEEMEKRGLPCREIRCREVGIRMVHGEPVAELSRYEK
IVYEASGGLEYFFQAVGDDGTLYGILRLRIPAQPWRPEIDARTALVREIHVYGPEVPIGR
RSVWPQHRGIGRRLMELAEGAAVESSAKKVVVIAGVGARPYFKKLGYSRCGPYMCKRL
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
gtgattcgtagacctaagccggaagacgacggggcggaggtctcgcccatcaagaggccc
gtcagagccgccagcggcgtccacgtagtcgccgttatgacggggcctctcagctgtccg
ggggaatgcgtgttctgccccacggcgaggggcgtgcccaagtcgtatctgcccgactcg
cccgccgtgttgagggctctgagggccagatacgacccctataggcaagttatggccaga
ataaagaattatctagcgggaggccacgagcccaacaaaatcgaggtgatagttatgggc
gggacgttcacggcgctacctcgccagtatcagttctggtttgtaggcaacgtcctcaag
gccttgaacgattatccacagtggtcatccgccgctccctcggtcgacgtagagctggag
caggagcgtaacgagggggcaacgctgaggcttgtggctctcactgtggagaccaggcct
gactacgtggagaagcgccatatagatgacttgttgtcgctgggagtcactagggtcgag
ctgggcgtacagtccatctacgacgatgttctgaggctcacgaagaggggccacggcgtt
aaggaggtcgtggacgccacagccagactgaaggacgccgcctataaagtgtgttatcac
ctcatgcctgggctcccaggcagcgacccggacagagacctcgatatgttcagagccgtg
ttcgaggatccctcgttccgtccggactgtgtcaagatatatccgaccttcgtcgtgccc
gggacagagttgtacgagtggtggaggaggggcatctatcgctcctacgacgaggagact
tggcgggagctcctcgccaaaatatatgcgttggtccccccgtgggtgagagttatgagg
ctgggccgggacatccccctccaccacgtggttgacgggcccagatggggcaacatgagg
gaggtcgtcgaggaggagatggagaagaggggtctcccgtgtagagaaatccgttgtaga
gaggtcggcataaggatggtgcacggcgagcctgtagctgagctctccagatatgagaag
atagtgtatgaggcgagcggaggactcgagtatttcttccaagctgtcggcgatgacggc
actttatatgggatcctgaggctcagaattccggcgcagccctggaggcccgagatagat
gcgcgcactgcgttggtgagagagatccacgtctacggccccgaggtgcccattgggagg
aggagcgtgtggccgcaacacagagggataggccgcaggctgatggagctcgctgagggc
gcggccgttgagagctcggccaaaaaagtcgtagttatagctggcgtcggcgccaggccc
tacttcaaaaagctcggctactctaggtgtgggccctatatgtgtaaaaggctctag

DBGET integrated database retrieval system