KEGG   Thielavia terrestris: THITE_2109948Help
Entry
THITE_2109948     CDS       T02228                                 

Definition
hypothetical protein
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ttt  Thielavia terrestris
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ttt00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    THITE_2109948
Enzymes [BR:ttt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     THITE_2109948
Exosome [BR:ttt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   THITE_2109948
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:join(7423209..7423540,7423669..7424669,7424745..7425172)
Genome map
AA seq 586 aa AA seqDB search
MVHSANPIPARVENTVVPGVEDTVIPGGPKSSLDGPFMKPTTADGLVNLSPHHEDHLPGG
ILETDEERERRWFVGSIDQGTTSSRFLIFNGEGDPVASHQLEFENLYPKSGWHEHDPLEL
LRSVEECIDEAVRKFVDLGYSISDIRSIGITNQRETTVVWDSVTGEPLHNAIVWPDTRTQ
ALVRELKSRESSDSLLDLCGLPLSTYPSSVKLLWLLRNVDSVKQAYEEGRLAFGTVDSWL
IYRLNGGANAAKPVHVTDSTNASRTMFMNLRTLQYDDKLLGFFGIDRTKVQLPKIVPSSD
PECFGKLASGPLAGIPIAGCLGDQSSALVGQCGFSPGQAKNTYGTGCFLLYNVGTEPVIS
KYGLLATVAYDFGRGRKPVYALEGSIAVAGAGVKFLMNNLGFGTQSSDITSLAESVPDNG
GVVFVTAFSGLFAPYWIDDAKGTLFGITQHTTKAHIARATLEATCYQTRAILEAMEKDSN
HKLESLAVDGGLSNSDLCMQTQADVCGIPVDRPRMRETTALGAAIAAGLATGVWRELDDL
KEVNRNGRKVFLPQMDKAKADRLFRKWEQAVEMSRGWVREDNSDFE
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atggtccacagtgcaaacccgattccagctcgcgttgagaacacggtcgtccccggcgtt
gaggacacggtcatccccggcggtccaaaatcaagcctggacgggccgtttatgaagccc
actacagccgacggcctcgtcaacttgtcccctcaccacgaagaccatctcccgggggga
attttggagacggacgaggagagggagcgccgctggttcgtcggcagcatcgaccagggc
accacgtcgtcacgcttccttattttcaacggcgagggcgaccctgtcgcgagccatcag
ctagagtttgagaacctgtaccccaagtcaggatggcacgagcatgatcctctcgaactt
ctacgctccgtcgaggagtgcattgacgaggccgtgcgcaagtttgtcgacctggggtac
tcgatatccgacatccggtcgatcggcatcacgaaccagcgcgagacgacagtagtgtgg
gacagcgtcaccggcgagcccttgcacaatgccattgtctggcccgacacccgcacacag
gcgctcgtgcgcgagctcaagtcgcgcgagtcatcagatagccttttggacctctgcggt
ctgcccctctccacgtaccccagcagtgtcaagttgctctggctccttcgaaacgtagat
tccgtgaaacaagcgtatgaggaaggccggctcgcgtttggaaccgtcgactcctggctc
atctaccggctcaacggcggtgcaaatgccgccaagcccgtccatgtgaccgacagcact
aacgccagcaggactatgttcatgaacctgcgcaccctgcagtacgacgacaagctgctg
ggattttttggcatcgacaggaccaaggtgcagctgcctaagattgtgccgtcatcagac
cccgagtgcttcgggaagctcgccagtgggccgctggcgggcatccccatcgccgggtgt
ttgggcgaccagtctagcgccctggtcggccagtgcggcttcagtccgggtcaggccaag
aacacatacggtactggctgcttcctcctgtacaatgtcggcaccgagcccgtcatctcc
aagtacggtcttctggccacggtagcctacgacttcgggcgcggcaggaaaccagtgtat
gccctcgaggggagcatcgccgtcgccggcgctggcgtcaagttcctcatgaacaacctc
ggctttggcactcaatcaagcgacatcacctccctggccgaatcagtgccggacaacggt
ggcgtcgtcttcgtcacagccttcagcggcctcttcgctccgtactggatagacgacgcc
aagggcacgctcttcggcatcacgcagcacacgaccaaggcgcacatcgcgcgcgccacg
ctcgaggcgacctgctaccagacgcgcgcgatcctcgaggccatggagaaggactcgaac
cacaagctcgagtcgctcgccgtcgacggcggcctgtccaactcggacctgtgcatgcag
acgcaggccgacgtctgcggcatcccggtcgaccgcccgcgcatgcgtgaaaccacggcc
ctcggcgccgccatcgccgccggcctggccaccggcgtctggcgcgagctcgacgacctc
aaagaggtcaatcgcaacggccgcaaggtgttcctgccgcagatggacaaggccaaggcg
gacaggttgttccgcaagtgggagcaggccgtggagatgagtagggggtgggtcagggag
gacaattctgattttgagtag

DBGET integrated database retrieval system