KEGG   Thielavia terrestris: THITE_2118958Help
Entry
THITE_2118958     CDS       T02228                                 

Definition
(RefSeq) hypothetical protein
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
ttt  Thielavia terrestris
Pathway
ttt00330  Arginine and proline metabolism
ttt00332  Carbapenem biosynthesis
ttt01100  Metabolic pathways
ttt01130  Biosynthesis of antibiotics
ttt01230  Biosynthesis of amino acids
Module
ttt_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:ttt00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    THITE_2118958
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    THITE_2118958
Enzymes [BR:ttt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     THITE_2118958
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA SOG2
Motif
Other DBs
NCBI-GeneID: 11524351
NCBI-ProteinID: XP_003655348
JGI: Thite2_2118958
UniProt: G2RB41
Position
4:join(1706427..1706466,1706542..1706729,1706781..1706891,1706952..1707222,1707277..1708265)
Genome map
AA seq 532 aa AA seqDB search
MRGPRPLGVVIKLGTSSIVDEKTHEPLLSILTSIVETAVKLRKDGHKVIIVSSGAIGVGL
RRMDVEKRPKHLSKLQALAAIGQCRLMSLWDSLFAHLRQPIAQILLTRSDIADRSRYLHA
QRTVNELLDMGVIPIVNENDTLAVAEIKFGDNDTLSAVTAAMVHADLLFLMTDVDCLYDK
NPRTHPDAHPIEVVEDIGSLVADVSSAGSSLGTGGMSTKIVAARLATSAGVTTVITRSSN
PGNIIKIVQHIQASRSPPSLATKANQPPETTETQQQPQPQQHEPHLPTDPTADYASSSSA
ASTLTPSSSSSSSRTLTPTPTPTPTPTPTPTPAPKTIPLHTRFLPSPHPVRDRYFWILHG
LRPHGTLYIDQGAFRALLGRAGLLPAGVVDVEGVFAQHEAVRLCVVERRRAGVEEDATTA
ATAGGAAGGVGGGGGGGGGGNGAKLWEGSAQEVGRALTNYSSAEIARIKGRQSTEIEGLL
GYMDSEYVAPRGSISIFAGAGAGVKGSRPATPVREVVDGRGIGGYEVEGAVL
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgagggggccgcgtccgctcggcgtggtgatcaagctgggaacgagctccatcgtggac
gagaagacgcatgagccgctcctgtccatcctcacgtcgatagtggagacggctgtgaag
ctgaggaaggatggtcacaaggtcatcatcgtctcgtccggcgccatcggcgtcgggctg
cggcggatggacgtggagaagcggccgaagcatctgtcaaagctccaggctcttgcagcc
attggccaatgccggctgatgagtctctgggacagcctgttcgcccatctcaggcagccc
atcgcccagattctgctcaccagaagcgacatcgccgatcgatcacggtacctccacgcg
cagaggaccgtcaacgagctgctggacatgggcgtcatccccattgtcaacgagaacgac
acgctggccgtggcggaaatcaagtttggcgacaacgacacgctctcggccgtcacggct
gccatggtccacgcagacctcctgttcctcatgaccgacgtcgactgtctgtacgacaag
aacccgcggacgcatcctgacgcccaccctatcgaggtggtcgaggatatcgggtcgctc
gtcgcagacgtctcgtccgccggctcgtccctcgggacaggcggcatgtccaccaagatc
gtcgccgcccgcctcgccacgtccgccggcgtcaccaccgtcatcacgcggtcctcgaac
ccgggcaacatcatcaagatcgtccaacacatccaggccagccgctccccgccctcgctc
gccaccaaggccaaccaacccccggaaaccaccgagacccagcagcaaccgcaaccacaa
caacacgaaccgcacctccccaccgaccctaccgcagactacgcctcctcctcctccgca
gcaagcacgctcaccccctcctcctcctcctcctcctcccgcaccctgacgccgaccccg
accccgaccccgaccccgaccccgacccccacgccagccccgaagacgatcccgctgcac
acgcgcttcctcccgtcgccgcacccggtgcgcgaccgctacttctggatcctgcacggc
ctgcgcccgcacggcacgctgtacatcgaccagggcgcgttccgcgcgctgctgggccgc
gccgggctgctgcccgccggcgtggtcgacgtggagggcgtgttcgcgcagcacgaggcc
gtgcggctgtgcgtggtcgagaggaggcgcgctggggtggaggaggatgctactactgct
gctactgctggtggtgctgctggtggtgttggtggtggtggtggtggtggtggtggtggt
aacggggccaagctgtgggagggcagcgcacaggaggtggggcgggcgctgaccaactac
tctagcgcggagatcgcgcggatcaaggggcggcagagcacggagatcgaggggcttctg
gggtatatggatagcgagtatgtcgcgccgagggggagcatcagtatctttgccggggcc
ggggccggcgtgaaggggagcaggccggcgacgccggttagggaggtggtggacgggcgc
ggcattggcgggtatgaagtggaaggggcagtgttgtga

DBGET integrated database retrieval system