KEGG   Teredinibacter turnerae: TERTU_3323Help
Entry
TERTU_3323        CDS       T00952                                 

Gene name
cobD
Definition
cobalamin biosynthesis protein CobD (EC:4.1.1.81)
Orthology
K02227  
adenosylcobinamide-phosphate synthase [EC:6.3.1.10]
Organism
ttu  Teredinibacter turnerae
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:ttu00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3673387..3674331)
Genome map
AA seq 314 aa AA seqDB search
MVSLAILLLAWWLDTRLGEPARFHPLVGFGNYAAWLERQLRRLPLAARWQGIIAFLLAML
PVVPFAFAAAIFSGGFYVLLGSLVVYLAMAYRALREHALHVYRALEAEDLPLARLEIAKI
VSRETAELSEGEVCTACIESVLENGSDAIFSAWFWWLLLGFPGVVLYRLVNTLDAMWGYK
NTRYRYFGWAAARADDVMNYLPARSVAWCYSLAGNAKQGLRCWREQGYRWKSPNAGPVMA
AGAGSLTITLGGAARYHGVMQTRMTLGVGATPVAQDILRALNLVRLALWIWLAHAVVVCV
GIFLLFSLIERGFV
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atggtttctcttgcaattttactgctcgcctggtggctggatacccgtctgggtgagcct
gcgcggtttcatccgttggtggggtttggcaattatgcagcttggctggaacgccagcta
cggcgattgccgctggcggcgcgttggcagggcattatcgcgtttttactggcaatgctg
ccggtggtgccgtttgcgtttgccgctgcgatattttccggcgggttctatgtgctgcta
ggcagtctggtggtctatttagcgatggcttaccgggcattgcgcgaacacgccttacat
gtttaccgcgcacttgaggccgaggacctgccgctggcacggctggagatcgcaaaaata
gtcagccgcgaaacggctgaactcagtgagggcgaagtctgtaccgcttgcatagaatcc
gtattggaaaatggcagcgacgcaattttttcggcatggttttggtggctgttattgggg
tttcccggcgttgtgctatatcggttggttaacacactcgatgcaatgtgggggtataaa
aatacccgctatcgctatttcggttgggcggcggcgcgggcggacgacgttatgaattat
ttacccgcgcgttcggttgcctggtgctattcacttgcgggcaacgccaagcagggtttg
cgctgttggcgggagcaggggtaccgttggaaaagcccgaacgctggcccggttatggct
gcgggtgccggcagtttaaccatcacgcttggcggtgctgcgcgctatcatggcgtaatg
caaacacgtatgacgctaggtgtgggtgctacgcctgttgcgcaggacattttgcgcgca
cttaatctagtgcgcctggcgctgtggatttggctggcgcatgcggttgtcgtgtgcgtt
ggaatatttctcttattttctttaattgaaagaggtttcgtgtga

DBGET integrated database retrieval system