KEGG   Teredinibacter turnerae: TERTU_3323Help
Entry
TERTU_3323        CDS       T00952                                 

Gene name
cobD
Definition
cobalamin biosynthesis protein CobD (EC:4.1.1.81)
Orthology
K02227  
adenosylcobinamide-phosphate synthase [EC:6.3.1.10]
Organism
ttu  Teredinibacter turnerae
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Module
Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:ttu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    TERTU_3323 (cobD)
Enzymes [BR:ttu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.1  Acid-D-ammonia (or amine) ligases (amide synthases)
    6.3.1.10  adenosylcobinamide-phosphate synthase
     TERTU_3323 (cobD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3673387..3674331)
Genome map
AA seq 314 aa AA seqDB search
MVSLAILLLAWWLDTRLGEPARFHPLVGFGNYAAWLERQLRRLPLAARWQGIIAFLLAML
PVVPFAFAAAIFSGGFYVLLGSLVVYLAMAYRALREHALHVYRALEAEDLPLARLEIAKI
VSRETAELSEGEVCTACIESVLENGSDAIFSAWFWWLLLGFPGVVLYRLVNTLDAMWGYK
NTRYRYFGWAAARADDVMNYLPARSVAWCYSLAGNAKQGLRCWREQGYRWKSPNAGPVMA
AGAGSLTITLGGAARYHGVMQTRMTLGVGATPVAQDILRALNLVRLALWIWLAHAVVVCV
GIFLLFSLIERGFV
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atggtttctcttgcaattttactgctcgcctggtggctggatacccgtctgggtgagcct
gcgcggtttcatccgttggtggggtttggcaattatgcagcttggctggaacgccagcta
cggcgattgccgctggcggcgcgttggcagggcattatcgcgtttttactggcaatgctg
ccggtggtgccgtttgcgtttgccgctgcgatattttccggcgggttctatgtgctgcta
ggcagtctggtggtctatttagcgatggcttaccgggcattgcgcgaacacgccttacat
gtttaccgcgcacttgaggccgaggacctgccgctggcacggctggagatcgcaaaaata
gtcagccgcgaaacggctgaactcagtgagggcgaagtctgtaccgcttgcatagaatcc
gtattggaaaatggcagcgacgcaattttttcggcatggttttggtggctgttattgggg
tttcccggcgttgtgctatatcggttggttaacacactcgatgcaatgtgggggtataaa
aatacccgctatcgctatttcggttgggcggcggcgcgggcggacgacgttatgaattat
ttacccgcgcgttcggttgcctggtgctattcacttgcgggcaacgccaagcagggtttg
cgctgttggcgggagcaggggtaccgttggaaaagcccgaacgctggcccggttatggct
gcgggtgccggcagtttaaccatcacgcttggcggtgctgcgcgctatcatggcgtaatg
caaacacgtatgacgctaggtgtgggtgctacgcctgttgcgcaggacattttgcgcgca
cttaatctagtgcgcctggcgctgtggatttggctggcgcatgcggttgtcgtgtgcgtt
ggaatatttctcttattttctttaattgaaagaggtttcgtgtga

DBGET integrated database retrieval system