KEGG   Thermoproteus uzoniensis: TUZN_1613Help
Entry
TUZN_1613         CDS       T01460                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
tuz  Thermoproteus uzoniensis
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:tuz00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    TUZN_1613
Enzymes [BR:tuz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     TUZN_1613
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1402603..1403529
Genome map
AA seq 308 aa AA seqDB search
MALVASIGNLNYDIYIKTPELPGLDQSVDAVDIYTGGGGSAANFAVAITRMRHRARFIGS
VGDDVLGDMILRELAGEGVDVSFVKRIKGVRSGVVVVLVQPDGVKRMIAYRGANMGLSPD
DINEESLGGVDHVHIASGRVELILKAKEVAKRLGKTVSVDGGTALARKGLEIASKALSGV
DVVLMNQVEAKMLASSADHRAAVDVIAKSINAKEVVITLGDRGAMAVSDGEFIYVDAFKL
QPVDTTGAGDTFAAAYIAARLAGLSLYERLLFANAAASIKVTRPGARSSPKFEEVAEFLK
SLGYRIAD
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
gtggccttggtcgcgtctatagggaatttgaactacgacatatatataaaaacgccggag
ctgcccggcttagaccagtcagtggacgccgtggatatatacaccggagggggcggctcg
gcggcgaacttcgccgtggcgataaccaggatgaggcatagggcgaggttcataggctcc
gtcggcgacgacgtgttgggggacatgatactgagagagctcgccggcgagggggtcgac
gtgtccttcgtcaagaggattaagggagttaggtcgggggtcgtggtcgtcttggtccag
cccgacggcgtgaagcggatgatagcgtacagaggggccaacatgggcctgtcccccgac
gacataaacgaggagtcgctgggcggcgtcgaccacgtccatatagcgagcgggcgcgtg
gagctcatactcaaggcgaaggaggtcgccaagaggctcggcaagacggtctcggtcgac
gggggcacagcgctggcgaggaagggcttggagatagcctcgaaggccctctcgggcgtc
gacgtggtgttgatgaaccaggtggaggccaagatgttggccagctcggccgaccacaga
gcggccgtcgacgtcatagccaagagcataaacgcgaaggaggtcgtgataacgctcggc
gataggggcgccatggccgtcagcgacggcgagttcatctacgtagacgcgttcaagcta
cagcctgtcgacactacgggcgccggcgataccttcgccgccgcctacatagccgctagg
ctggccgggctctcgctctacgagaggctcctcttcgccaacgccgcggcctccatcaag
gtcacgaggcccggcgcgcggtcctcgcccaagttcgaggaggtggccgagttcctcaag
tctctgggctacaggatcgcggattaa

DBGET integrated database retrieval system