KEGG   Trichophyton verrucosum: TRV_03042Help
Entry
TRV_03042         CDS       T01615                                 

Definition
hypothetical protein
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
tve  Trichophyton verrucosum
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:tve00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    TRV_03042
Enzymes [BR:tve01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     TRV_03042
Exosome [BR:tve04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   TRV_03042
  Exosomal proteins of colorectal cancer cells
   TRV_03042
  Exosomal proteins of bladder cancer cells
   TRV_03042
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 523 aa AA seqDB search
MPGVRSLLLALAGVSLAPAVLAADASTDSSDVHVLKTDTFKDFIKEHDLVLAEFYAPWCG
HCKALAPEYEKAATELKGKNIQLAKVDCTEEADLCQEYGVEGYPTLKVFRGLDSHKPYNG
ARKSPAITSYMVKQSLPSVSVVTAENFEEVKSLDKVVVVAFIGEDDKETNKTYTALADSM
RDDVLFAGTSSAELAKKEGVSLPAVVLYKEFDDRKDVYDGKFEAEALKAFIKSSSTPLVG
EVGPETYSGYMSAGIPLAYIFADTAEEREQYASDFKDLAKKLKGKINFATIDSKAFGAHA
ANLNLIPEKFPAFAIQDTVSNKKYPFDQEKKLTKQDITKFVEGVIAGDIAPSVKSEAVPE
TNDGPVTVIVAHTYEEIVMNKDKDVLVEFYAPWCGHCKALAPKYDQLGSLYKDNKDFASK
VTIAKVDATANDIPDEIQGFPTIKLFPAGDKDKPVEYTGSRTIEDLANFVRDNGKHKVDA
YDEKKVEKDGSDVTGKPKDAEAPPKPSDAPESEEKADKEHEEL
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgccgggcgtccgtagcctcctccttgccctcgccggcgtctctctcgctcccgccgtg
ctcgccgcagacgcctcgacagactcgtcggacgtccacgtcctgaagacagacaccttc
aaggacttcatcaaggagcatgacctcgtcctggctgagttctacgccccctggtgcggc
cactgcaaggccctcgctcccgaatatgagaaagcagccaccgagctcaagggcaagaac
atccagctcgcaaaggtcgactgcaccgaggaggccgacctctgccaggagtacggcgtc
gagggataccctacactcaaggtcttccgtggccttgactcgcacaagccttacaacggt
gctcgcaagtccccagccatcacctcatacatggtcaagcagagcctgccatcagtctcg
gttgtgacagcagaaaacttcgaggaggtcaagtccctggacaaggtcgtcgtcgtcgcc
ttcattggcgaggacgacaaggagaccaacaagacctacactgccctcgctgactcaatg
cgggacgatgtcctctttgccggcaccagcagcgctgagctggccaagaaggagggtgtc
tcgctccccgctgttgtcctctacaaggaattcgatgaccgcaaggacgtgtatgatggc
aagttcgaggccgaggccctcaaggctttcatcaagtcctccagcacacccctcgttggc
gaggttggcccagagacctactctggatacatgtcggctggcatccctcttgcatacatc
tttgctgacactgctgaggagcgtgagcagtacgctagtgacttcaaggacctcgccaaa
aagctaaagggcaagatcaacttcgctaccatcgactccaaggcctttggtgctcacgct
gccaacctcaaccttatccctgagaagttccctgccttcgccatccaggacactgtttcc
aacaagaagtaccccttcgaccaggagaagaagctcaccaagcaagacatcaccaagttc
gttgagggtgtcatcgccggtgacattgctcctagtgtcaagtccgaggccgtcccagag
acgaatgacggccccgtcaccgtcatcgtcgcccacacctacgaggagatcgtcatgaac
aaggataaggatgtcctcgtcgagttctacgctccttggtgcggacactgcaaggctctc
gcccccaagtacgaccagctcggcagcttgtacaaggacaacaaggacttcgcctccaag
gtgaccatcgctaaggtcgatgccaccgccaacgacatcccagacgagatccagggcttc
cctaccatcaagcttttccctgccggcgataaggataagccagtcgagtacaccggctct
cgcaccatcgaggacctcgccaacttcgtccgtgacaacggcaagcacaaggtcgacgcc
tacgatgagaagaaggtcgagaaggatggcagcgatgtcactggaaagccaaaggatgcc
gaagccccaccaaagccttctgatgctcccgagtccgaggagaaggctgacaaggagcat
gaggagttgtag

DBGET integrated database retrieval system