KEGG   Trichophyton verrucosum: TRV_05979Help
Entry
TRV_05979         CDS       T01615                                 

Definition
hypothetical protein
Orthology
K03259  
translation initiation factor 4E
Organism
tve  Trichophyton verrucosum
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:tve00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    TRV_05979
Translation factors [BR:tve03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    TRV_05979
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 384 aa AA seqDB search
MENANLWTRRSNSAKLSLSTSGSDSKDGAGKSDSSRGRSAGRFDGSHPRSNPFNAISPLS
STVSSPSVAASSAFGLGSGAFASFGSTAKSSKTANSPDAIAGKQQGDKRDIQADQEGGAW
KPVKSKASSSSLDKSASSANKDNGVRELPLKSTWIVWYRPPTPKYSDYEKSTIPLASISS
VESFWTVYSHLKRPSLLPTVSDYHIFKKNIRPVWEDEANKKGGKWIIRLKKGVADRYWED
LLLAMIGDQFAEASDEVCGAVLSVRSGEDVLSIWTKIDGGRNIKIRHATFSSTSCFGRRI
RWLTSMHRETIKRLLAFPPDTNIIWKSHDDSIAQRSAIDQARLDKSSGNSGHHHHHHHNQ
GADRRRIANQEDSTGERGKNTTNS
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atggagaacgctaatttatggactcgaagatctaactctgcaaaactctccttgtcgacg
tccggctctgatagtaaagacggtgctggaaagtcggattcatctcgtggtcgttccgca
ggccgcttcgacggctcgcaccctcgctcaaacccattcaacgccatatcgcctctctct
tctacagtctcttccccctccgtggccgcatcatctgcctttgggctgggctcaggcgcc
ttcgcttcattcggatcgacggcgaagtcgtctaagaccgccaactcccctgacgctatc
gccggtaaacaacaaggcgataagcgagatatacaagccgaccaggaaggcggggcttgg
aaaccagtcaagtcaaaggcgtcttcgtcttctcttgacaagtccgcgtcttcggccaat
aaggataacggagtgagggagcttccgctcaagtctacgtggattgtctggtaccgtcct
ccgacacccaagtactctgattacgagaaatctactatccctctcgcctctatatcttcc
gttgagagcttttggaccgtttattcacacctcaaacgaccttccttgctaccgactgta
tcggactaccatatattcaagaaaaacattcgtcctgtatgggaggatgaggccaataaa
aagggcggcaaatggattatcaggctgaagaagggagttgcggatcgatattgggaagat
ctgctcctggcaatgattggggatcagtttgccgaggcaagcgatgaggtctgcggcgcg
gtcctcagtgtcaggagtggggaggacgttctgagtatatggaccaagatcgatggtggc
cgcaacatcaagatcaggcatgctacatttagttccacttcttgttttggccgtagaata
cgatggctaacatcgatgcacagggaaaccattaagcgtcttcttgccttccccccggat
acaaacatcatctggaaaagccatgatgacagcatagcacagagatcagctatagaccaa
gcgcgcctggataaatccagcggcaattccggtcaccaccaccatcatcaccacaatcaa
ggtgctgaccgccgccgcatcgccaaccaggaagattccactggcgaaaggggtaagaat
accacgaattcttaa

DBGET integrated database retrieval system