KEGG   Variovorax paradoxus S110: Vapar_0035Help
Entry
Vapar_0035        CDS       T00916                                 

Definition
hypothetical protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
vap  Variovorax paradoxus S110
Brite
Enzymes [BR:vap01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     Vapar_0035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(37067..37945)
Genome map
AA seq 292 aa AA seqDB search
MSARDPSDLLSVVHPAVRRTAIVLLHGLCSTPDELLTVQSSLRASGYPVHPMRVDGYSFD
AAAPVQQALPYERWIDAIEARVKALRTAHDRVVLVGISAGSSLALGAAIRCGSGVDALVL
MSTTLRFDGWAVPRTQVLLPLAFYTPLGRFWQYRERAPYGVKNERVRAWIERELRHRKVS
SAGSAVIGVGHLREHDRLIRHVRRNLHRVQCASVLALHAREDEVASLANVDLLARGLRCQ
SFRSVVLGNSYHMITIDNDRHQVVRETCAFADAVAHGTPEPFGALSARPLAA
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcccgcgatccctccgatctcctgagcgtcgtgcatcccgcggtgcggcgcacg
gccattgtgctgctgcatggtttatgcagcacacctgacgagctcctgaccgtgcaatcg
tccctgcgcgcgagtggctacccggtgcatccgatgcgtgtcgacggctactccttcgat
gccgccgcaccggtgcagcaggcgctgccgtacgaacgctggatcgacgccatcgaagca
cgggtgaaggcgctgcgcacagcgcacgatcgcgtggtgctggtgggcatctcggccggt
tcgtcgctggcgctgggcgcggccatccgctgcggcagcggcgtcgatgcgctggtgctg
atgtcgaccacgctgcgcttcgacggctgggccgtgccgcgaacgcaggtgctgctgccg
ctggccttctacacgccgctcggccgcttctggcaataccgcgaacgcgcgccctacggc
gtgaagaacgaacgcgtgcgtgcctggatcgagcgcgagctgcgccaccgcaaggtgtcg
agcgccggcagcgcggtgatcggcgtgggccacctgcgcgagcacgatcggctgatccgc
cacgtgcggcgcaacctgcaccgcgtgcaatgcgccagcgtgctcgcgctgcatgcgcgc
gaggacgaggtggccagcctcgccaatgtcgacctccttgcgcgcggccttcgctgccag
tccttccgcagcgtggtgctgggcaacagctaccacatgatcacgatcgacaacgaccgc
caccaggtggtgcgcgaaacctgcgccttcgccgatgccgtggcccacggcacgcccgag
cccttcggcgccctgtccgcgcgcccgctggccgcctga

DBGET integrated database retrieval system