KEGG   Vibrio cholerae LMA3984-4: VCLMA_A1385Help
Entry
VCLMA_A1385       CDS       T01871                                 

Definition
aldose 1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
vcl  Vibrio cholerae LMA3984-4
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:vcl00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:vcl00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(1582643..1583695)
Genome map
AA seq 350 aa AA seqDB search
MNALFTSMTAQVAYDGQPTKLIELTNRRGMRVVVMDIGATWLSCTLPMGDESREVLLGVS
SMDDFVRQGSYLGATVGRYANRIARGELKIGTQTYALSVNQAGNTLHGGVVGFDRRRWQI
TQQSAQRVTFQLLSADGDQGFPGNLHVAVTYRLDEQGGVNIDYQATTDRATAVNLTNHAY
FNLNGAEQGSDCLNHQLWIDAKQFLPTDASGIPLGELQSVLGSGFDFTQPKRVGEDLLQD
KQQIRAKGYDHSYFFAPERDMHTPIAKVWSADEKVQLLVSTDKPAMQLYTGNWLAGTPNR
LGSHYKDYAGLALETQFLPDSPHHPEWPQPSCILQPGEVYRYQTRYQFVF
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcgttattcaccagcatgacagcacaggtcgcctatgatggtcagcctaccaag
cttattgagctcactaaccgccgcggtatgcgtgtggtagtgatggatatcggtgccact
tggctcagttgcactctaccgatgggcgatgaatcaagagaagtgctacttggcgtaagc
agcatggatgattttgtgcgccaaggcagttatttaggcgcaacggtggggcgttatgcc
aatcggattgcgcgtggcgaactcaagatagggacacaaacgtatgctttgtcggtcaat
caagctggcaatacgttacacggtggcgttgtagggtttgatcgtcgtcgctggcaaatc
acgcagcaaagcgcacagcgtgtgacctttcaactgctttctgctgacggagatcaaggc
tttccaggcaacctccacgttgcggtgacctaccggttggatgagcaaggtggggtgaat
atcgactaccaagccaccaccgatcgtgcgaccgccgtgaatctaacgaaccacgcctac
tttaatttgaatggcgctgagcaaggtagtgattgcctcaatcatcagctctggattgat
gcaaagcagttcttaccaacggatgcctcgggtatcccgctcggggagttgcaatcggta
ctgggtagcggttttgatttcactcaaccgaaaagggttggggaagatttgcttcaagat
aaacagcaaatccgtgcgaaaggctatgaccacagttatttctttgcgccagagcgtgat
atgcacacacccatcgctaaggtctggtctgccgatgagaaagtgcaactgctcgtcagt
acggataaacctgctatgcagctttataccggtaattggttggcgggaacacccaatcgc
cttggttcgcactacaaagattatgcaggcctcgctttagaaacgcagtttttacccgac
tctcctcatcatccagaatggccgcaaccgagctgcatcttgcaacccggagaagtttat
cgctatcaaacacgctatcagtttgttttttaa

DBGET integrated database retrieval system