KEGG   Vibrio cholerae M66-2: VCM66_2329Help
Entry
VCM66_2329        CDS       T00891                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
vcm  Vibrio cholerae M66-2
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:vcm00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:vcm00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(2513027..2514565)
Genome map
AA seq 512 aa AA seqDB search
MLLMKTASKTNNSVRRNMNTHSAISELIAPWLELTDPKLAALVITHLELDSRLIKSGDTF
VAIQGHAVDGRQFIDKAIAQGANLVLAEADAQHLNGWVEYRAGVPVIYLAELGQHLSELA
GRLYGGHHNQLIGVTGTNGKTTITQLIAQWLELLGHKAAVMGTTGNGFLNALEPAANTTG
NALQIQATLRDLAERGAQYTALETSSHGLVQGRVKKLHFVAGVFSNLSRDHLDYHGTMEA
YAAAKFSLFSEHACQNAIINVDDAVGAQWVKQLPQAIGVSLVTKPNTAQAIWAREVAYAE
SGITLNFESSWGEGELHAPLIGEFNACNLLLALATLLSLGFEKSALLATAPKLRPVLGRM
ELFQREQKAKMVVDYAHTPDALEKALRALRVHCAGQLWAIVGCGGDRDRGKRPMMAAIAE
QFADRVILTDDNPRSESPQAIVADMVAGLTYPERAHIEHHRFQAASYALQHAGAQDIILL
AGKGHEDYQVLANETIHYSDRETAQQLLELQP
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
ttgctcctgatgaaaaccgcttccaaaacaaataatagtgtgagacggaacatgaacacg
cattcagcgatctccgaactgatcgcgccatggctagagctgaccgaccctaagttggcc
gcgctggtcattactcatcttgaactggatagccgcctgattaaatcgggtgataccttt
gtggctattcaaggccatgcagtggatggtcgccaatttatcgataaagccattgcgcaa
ggtgccaatcttgtgttggcagaagccgatgctcagcatctcaatgggtgggttgagtat
cgtgctggtgtccccgtcatctatttggctgaacttggtcaacatctgtcagagttggct
gggcgtctgtatggcggccaccacaatcaactgattggcgtgacgggcacgaacggtaaa
accaccatcacccagctgattgctcaatggctcgaattgctcggtcataaagctgccgtg
atgggcaccacggggaacggttttttaaatgcgcttgaacctgcggccaacaccacaggt
aacgcactgcaaattcaggccacactgcgcgatttagccgagcgcggcgcgcaatatacg
gcgctggaaacctcgtctcatggtttagtgcaagggcgcgtgaaaaagctccattttgtg
gccggtgtcttttccaatttgagccgtgaccatttggattatcacggcactatggaggct
tacgccgccgcgaaattctctctatttagtgagcatgcctgccaaaacgcgattattaat
gtcgatgatgcggtcggcgcgcaatgggtcaaacaattgccgcaggcgatcggggtttcc
ttagtgacgaaaccaaacacagcgcaagccatctgggcgcgcgaagtggcatacgctgaa
agcggtattacgctgaactttgagagttcgtggggagaaggcgaattgcacgcaccactg
attggtgagttcaatgcctgtaacttgttattggcattggcaaccttgctcagcttgggt
tttgagaaaagtgcactgctcgccactgcgccaaagctgcgtccagtcttaggacggatg
gagctattccaacgtgagcaaaaagccaaaatggtggtcgattatgcgcacacgccggac
gctttagaaaaagcactgcgcgcgttacgtgtacattgtgcgggtcagttgtgggctatt
gtggggtgtggcggcgatcgtgatcgcggtaaacgtccgatgatggctgcgattgctgag
cagtttgccgatcgcgtgatcttgaccgatgacaacccacgcagtgagtcgccgcaagcg
attgtagcggatatggttgcaggactgacttaccccgagcgcgctcatatcgaacaccac
cgtttccaagccgcgagttatgcgcttcagcatgcaggtgcgcaagacatcatcctgctc
gcgggtaaaggacatgaagattatcaggtgctggccaacgaaacgattcactactcggat
cgtgaaaccgcccaacagttactggagttacaaccatga

DBGET integrated database retrieval system