KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_61462Help
Entry
VOLCADRAFT_61462  CDS       T01330                                 

Definition
hypothetical protein
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
vcn  Volvox carteri f. nagariensis
Brite
Enzymes [BR:vcn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     VOLCADRAFT_61462
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 395 aa AA seqDB search
MKAAGGVSAAAAAQSALAPAGPDAGTAPPIPATAAGTAAAARTAPVQPSQTQQQQSYPTP
RTRIYYNPELSMFSLGEDHPMVPHRLHLTHRLAELWGLFDDPAVQVVRDYPPATTDQLRR
FHTDEYIAFLEYLDTLDLETMSDEDDDDDEGGDCPIFPGLLRYVGLQAAGSILAARDLAH
GLCDVAVHWGGGMHHGMPYRAFGFCYVNDLVLAILELMAVCGRVLYIGEVEGIFRATNDT
LNHGKPQRPVFFPGTGKKNDLGEGTGKYYTVNVPLQDDITDDSYFHVYKAVVKTAFERFK
PQAVVLQCGCDSVAGDKLGRFNLSIRGHSRQVEWGFGAWRVPLLVTGGGGYTPPLVARCW
TLETAVLLGMQLGEAMPPAVAKAEDLADLGPSYFK
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcaggaggtgtcagcgctgcagcggccgcgcagtcggccctggcacccgcc
gggccagacgcagggacagcacctcctatacccgcgacggctgcagggaccgcagcagcc
gcacgcaccgcgccagtccaaccttcgcaaactcaacaacagcagagctaccccactcct
cgcacacgcatctactacaaccctgagctgtccatgttcagcctaggggaagaccacccc
atggtcccgcaccgcctgcatctgacccatcgtctggcggagctgtggggcctgtttgac
gaccccgctgttcaagtcgtgcgcgattaccctccggccacaaccgaccagttgcgccgg
tttcacaccgacgaatacatcgccttcctagagtacttggacaccttggacttggagacc
atgtcagacgaggacgatgatgacgatgaggggggcgactgtcccattttccctggacta
cttagatacgtggggttacaggctgcgggcagtatccttgccgcacgcgacctggcgcat
gggctgtgcgatgttgccgtacactggggcggcggcatgcatcacggcatgccgtacagg
gcgtttggattctgttacgtcaacgacctcgtactggccattttggagctcatggcggtt
tgtggccgagtgctgtatattggtgaggttgaggggatttttagggccaccaacgacact
ctcaaccacggcaagccccagcgcccggtgttcttccccggcactggcaagaagaacgac
ctgggggaggggactggaaagtactacacggtcaatgtaccgctgcaggacgacattacg
gatgactcgtacttccacgtgtacaaggcggttgtgaagacggcatttgaacggttcaag
ccgcaggcggttgtgttgcagtgcggctgtgacagcgtggccggggataagttggggagg
tttaacctctccattagaggacactccaggcaagtggaatggggtttcggagcgtggcgc
gtacccctgctggtgactggagggggcggatacacaccgccgctggtggccaggtgttgg
actctggagaccgccgtgttgctcggcatgcagctgggggaggccatgccccccgcggtg
gcgaaggcggaggacctggcggacctgggcccctcgtacttcaagtaa

DBGET integrated database retrieval system