KEGG   Vibrio sp. EJY3: VEJY3_17606Help
Entry
VEJY3_17606       CDS       T01683                                 

Definition
(GenBank) putative acyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
vej  Vibrio sp. EJY3
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:vej00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    VEJY3_17606
   00630 Glyoxylate and dicarboxylate metabolism
    VEJY3_17606
   00640 Propanoate metabolism
    VEJY3_17606
   00650 Butanoate metabolism
    VEJY3_17606
  Lipid metabolism
   00071 Fatty acid degradation
    VEJY3_17606
   00072 Synthesis and degradation of ketone bodies
    VEJY3_17606
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    VEJY3_17606
   00310 Lysine degradation
    VEJY3_17606
   00380 Tryptophan metabolism
    VEJY3_17606
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    VEJY3_17606
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    VEJY3_17606
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    VEJY3_17606
Enzymes [BR:vej01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     VEJY3_17606
Exosome [BR:vej04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   VEJY3_17606
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2:393779..394987
Genome map
AA seq 402 aa AA seqDB search
MEKVYIVAAKRTPIGAFGGSLKNTSAGNLAAVAIKGALEAANLGSDKIDEVIVGNVVSAG
QGMGVGRQAAIFAGIPESVPAYGVNMVCGSGMKTVMDAVSHIRSGDAQVVVAAGVEVMSQ
IPFIVPSSVRDGNKMGNMELKDLLITDGLTDIYNQYHMGVTAENVAKEVGISREQQDAYA
LASQQKAVAAIEAGKFKDEIVPVEVTHRRETIIFDTDEYPKANATLEGLSKLRPAFDREG
TVTAGNASGINDGASAIIVASESAVQAHGLTPLAEVVSYAQSGIDPKIMGLGPVESVNKA
LKKAELNIQDIDVYELNEAFAAQALGVIHQLAETNQVPVSSIQDKANFNGGAIALGHPLG
ASGNRILVTLVHELHKQDAQYGVASLCVGGGMGTAVILKAIK
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaagtttatatcgtagcagcaaagcgtacacctattggcgcatttggtggaagt
ttaaaaaatacttcagcaggcaatctggcagcagtcgcaattaaaggggcgcttgaagct
gcaaatctcggaagcgacaagattgatgaagtgattgttggtaacgtcgttagtgctggc
caagggatgggcgttggtcgccaagcggcaatatttgcgggtattccggagtctgtacca
gcgtatggcgtcaacatggtttgtggtagtggcatgaaaaccgtgatggatgcggtttct
cacattcgaagcggtgatgctcaagtggttgttgctgcaggcgttgaggtgatgtctcaa
atcccgttcatcgttcctagtagcgtccgcgatgggaataaaatgggcaacatggaactg
aaagatctattgatcaccgatggcctaacggacatttacaatcagtaccacatgggtgtg
actgcggaaaatgtggcaaaggaagtgggcattagccgcgagcagcaagacgcgtatgct
ttagccagccaacagaaagcggttgccgcgattgaagcaggcaaattcaaagatgaaatc
gtaccggttgaagtaacgcaccgccgtgaaacgattattttcgacacagacgaataccct
aaggcaaacgcgacacttgaaggcttgagcaagcttcgcccggcatttgaccgtgaaggt
acagtcacagcgggtaatgcatcaggaatcaacgatggtgcgagtgcgatcatcgtggca
tcagaaagcgcggttcaagctcatggtttgacacctctggctgaggttgtcagctatgcg
cagtcaggtatcgatccaaagatcatggggctagggccagtcgagtcagtgaataaagcg
ctcaagaaagcagagcttaatattcaggatattgatgtatacgagctgaatgaagccttt
gccgctcaggctcttggggtgattcatcagttggctgaaacaaaccaagttccagtcagt
tcgattcaagataaagcaaactttaatggcggtgcgattgcattaggtcacccacttggt
gcctctggcaaccgaattctggtcactttagttcacgaacttcataagcaggacgcccaa
tacggtgtagcttcactgtgtgtgggtggcggtatggggacagctgtcattctaaaagca
attaagtaa

DBGET integrated database retrieval system