KEGG   Vibrio sp. Ex25: VEA_002513Help
Entry
VEA_002513        CDS       T01107                                 

Definition
5'-nucleotidase (EC:3.1.3.5)
Orthology
K03787  
5'-nucleotidase [EC:3.1.3.5]
Organism
vex  Vibrio sp. Ex25
Pathway
Purine metabolism
Pyrimidine metabolism
Nicotinate and nicotinamide metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:vex00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:vex00240]
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:vex00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:995804..996580
Genome map
AA seq 258 aa AA seqDB search
MEQDSLNAKPLRVLISNDDGVHAQGIHALADELRDIAEVTIVAPDRNRSGASNSLTLEQP
LRVTEIAPNIYSVQGTPTDCVHFALNELMKDDLPDLVLSGINHGANLGDDVLYSGTVAAA
MEGHFLGVQSVAFSLVGKRHFESAAKIARQIVQQHLASPIPTNRLLNVNVPDLPAENLGE
IEVTRLGARHHAENMIKQKDPRGHDIYWLGPPGKEQDAGEGTDFYAIEHGRVSMTPLQVD
LTAHESLRAMDSWLKEEK
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggaacaggattcactaaacgcgaagcccctaagagtcttaatcagcaacgacgatggc
gtacatgcgcaagggattcatgcacttgctgatgagttgcgagatatcgctgaagtgacc
attgtcgcacccgaccgaaatcgttcaggtgcttcgaattcactgacactagagcaacca
ttgcgcgtaactgaaattgccccaaatatctattcagtgcaaggaacgcctacagattgt
gtacatttcgcgctgaatgagctgatgaaagatgatttgcccgatcttgttttatcaggt
atcaaccacggtgcaaatttgggtgatgacgttctttactcaggaacggtagctgcagca
atggaagggcatttccttggtgttcagtcggttgctttttcgctggtgggtaagcgtcat
ttcgaatctgccgcaaaaattgcacgtcaaattgtgcaacagcatttagcgtctccgatt
ccaacgaatcggttattgaacgtaaacgtgcctgacttaccagcagaaaacctgggcgaa
atcgaagtcacgcgtttaggtgcgcgtcatcacgcagagaatatgattaagcagaaagat
ccgagaggccatgatatttattggttagggcctccaggaaaagagcaagatgcgggtgag
ggcaccgacttttatgcgattgaacatggtcgagtttcaatgacgcctctgcaagttgat
ctcactgctcatgagtcgctgcgtgcaatggatagttggttaaaggaagagaagtaa

DBGET integrated database retrieval system