KEGG   Vibrio sp. Ex25: VEA_002513Help
Entry
VEA_002513        CDS       T01107                                 

Definition
5'-nucleotidase (EC:3.1.3.5)
Orthology
K03787  
5'-nucleotidase [EC:3.1.3.5]
Organism
vex  Vibrio sp. Ex25
Pathway
Purine metabolism
Pyrimidine metabolism
Nicotinate and nicotinamide metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vex00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    VEA_002513
   00240 Pyrimidine metabolism
    VEA_002513
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    VEA_002513
Enzymes [BR:vex01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     VEA_002513
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:995804..996580
Genome map
AA seq 258 aa AA seqDB search
MEQDSLNAKPLRVLISNDDGVHAQGIHALADELRDIAEVTIVAPDRNRSGASNSLTLEQP
LRVTEIAPNIYSVQGTPTDCVHFALNELMKDDLPDLVLSGINHGANLGDDVLYSGTVAAA
MEGHFLGVQSVAFSLVGKRHFESAAKIARQIVQQHLASPIPTNRLLNVNVPDLPAENLGE
IEVTRLGARHHAENMIKQKDPRGHDIYWLGPPGKEQDAGEGTDFYAIEHGRVSMTPLQVD
LTAHESLRAMDSWLKEEK
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggaacaggattcactaaacgcgaagcccctaagagtcttaatcagcaacgacgatggc
gtacatgcgcaagggattcatgcacttgctgatgagttgcgagatatcgctgaagtgacc
attgtcgcacccgaccgaaatcgttcaggtgcttcgaattcactgacactagagcaacca
ttgcgcgtaactgaaattgccccaaatatctattcagtgcaaggaacgcctacagattgt
gtacatttcgcgctgaatgagctgatgaaagatgatttgcccgatcttgttttatcaggt
atcaaccacggtgcaaatttgggtgatgacgttctttactcaggaacggtagctgcagca
atggaagggcatttccttggtgttcagtcggttgctttttcgctggtgggtaagcgtcat
ttcgaatctgccgcaaaaattgcacgtcaaattgtgcaacagcatttagcgtctccgatt
ccaacgaatcggttattgaacgtaaacgtgcctgacttaccagcagaaaacctgggcgaa
atcgaagtcacgcgtttaggtgcgcgtcatcacgcagagaatatgattaagcagaaagat
ccgagaggccatgatatttattggttagggcctccaggaaaagagcaagatgcgggtgag
ggcaccgacttttatgcgattgaacatggtcgagtttcaatgacgcctctgcaagttgat
ctcactgctcatgagtcgctgcgtgcaatggatagttggttaaaggaagagaagtaa

DBGET integrated database retrieval system