KEGG   Aliivibrio fischeri ES114: VF_1607Help
Entry
VF_1607           CDS       T00236                                 

Gene name
folE
Definition
(RefSeq) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
vfi  Aliivibrio fischeri ES114
Pathway
vfi00790  Folate biosynthesis
vfi01100  Metabolic pathways
Module
vfi_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:vfi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    VF_1607 (folE)
Enzymes [BR:vfi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     VF_1607 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-GeneID: 3278879
NCBI-ProteinID: YP_204990
UniProt: Q5E4E4
Position
I:complement(1803595..1804248)
Genome map
AA seq 217 aa AA seqDB search
MSSLSESAILVRDALVARGLETPMKENGVSREEKKERIEEHMREILTLLSLDLSDDSLEE
TPHRIAKMYVDEIFSGLDYANFPKITVIENKMNCDEMVRVNDITLTSTCEHHLVTIDGKA
TVAYIPRGKIIGLSKINRIVRFFAQRPQVQERMTQQILVALQTLLGSDDVAITMEATHYC
VKSRGVMDATSSTTTTALGGIFKRNPATRHEFLSGIR
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcacttagtgaatcagccatattagtgcgtgatgctcttgttgcacgtggtctt
gagacgccaatgaaagaaaatggtgttagtcgagaagagaaaaaagagcgcatcgaagag
catatgcgtgagatcctaaccctattaagtcttgatcttagtgatgatagtttagaagaa
acgccacaccgtattgcaaaaatgtatgtggatgagattttctctgggctagattatgcc
aatttccctaaaattacagtgattgaaaataagatgaactgtgatgagatggttcgtgtt
aatgatattacgttaaccagtacttgcgaacatcacttagtgacaattgatggtaaagcg
acggttgcttatattcctcgtggaaagatcatcggattatctaaaattaaccgcattgtt
cgattcttcgctcaacgtccacaagtacaagaacgcatgactcagcaaatacttgtggct
ttacaaaccttattaggtagtgacgatgtagctattactatggaagcaacgcactattgt
gttaagtctcgtggtgtaatggatgcaacaagtagtacaacaacgactgcacttggtggg
atctttaagagaaacccagcgacaagacacgagtttttaagcggtattcgttaa

DBGET integrated database retrieval system