KEGG   Aliivibrio fischeri ES114: VF_A0882Help
Entry
VF_A0882          CDS       T00236                                 

Gene name
bcsZ
Definition
(RefSeq) endo-1,4-D-glucanase
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
vfi  Aliivibrio fischeri ES114
Brite
Enzymes [BR:vfi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     VF_A0882 (bcsZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
II:complement(996424..997602)
Genome map
AA seq 392 aa AA seqDB search
MKMQLTVLSLLIGTLTCSSSAIAQDENYTTPIVSSAALTKENQCEWGQWESFKQHYIENG
RVVDNSDPRLITTSEGQSYALFFALIANDKKTFDELLGWTELHLAGGDLTAQLPAWLWGR
QPDGSQGILDSNSAADSDLWIAYSLLEAGRLWDNHYYQSLGHLLASRILRDETIKVSGLG
TVLLPGKVGFVLGKNHVRLNPSYVPLQLLTRMNTVFPSYQWEEIYQSSAKLLKETMPKGY
SPDWVEWDKTQFKKDSKTQSVGSYNAIRVYLWAGMLPDSDPNKALLLDKMKPLVRVIERN
KGMPETINVLTGKGKNQGGVGMNAAILPLLSSLDSNTNAVEYEKKIQAELSKIESDYYYN
SVLTLFGLGWYQDLYSFNDDGSVTPKWVNVCQ
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatgcaattaacggtattgagtctattaattggcacgttaacttgctcttcttca
gctattgctcaagatgaaaattacacaaccccaatcgtttcatctgccgcactaacaaaa
gagaatcagtgtgaatgggggcaatgggaaagctttaaacaacattatatagagaatggt
cgagtcgttgataacagtgatcctcgtttaataacgacatcagaaggtcaatcttatgct
ctattttttgcattaattgcgaatgataaaaaaacatttgatgaattacttggttggact
gagttgcatttagctgggggggatctaacagcacaactccctgcttggttatggggaagg
caacctgatggctcgcaaggtattttagactcaaactcagcagctgactcagatttatgg
attgcttatagtctactcgaagccggaagattgtgggataaccattattatcaatctctt
ggacatttactggctagtcgaattttacgtgacgaaaccatcaaagtgtcaggtcttgga
acggtattattgccaggaaaagtgggatttgtattgggtaaaaatcatgttcgattaaac
ccaagctacgtcccattgcagttgctaactcgaatgaatacggttttccctagctaccaa
tgggaagaaatatatcaatcaagcgcaaaattactaaaagaaaccatgccaaaaggctat
agtcctgattgggttgagtgggataaaactcaatttaaaaaagattcaaagacccaaagt
gttggcagctataatgcgattagagtgtatttatgggcaggaatgctaccagatagcgac
cctaataaagcattgttacttgataaaatgaagccattagttcgtgttatagaaagaaat
aaaggcatgcctgagacaataaatgtgctaacaggaaaaggtaaaaatcaaggtggcgtc
ggaatgaacgcagctattttgcctttattatcttcgttagattcaaatacaaatgccgtt
gaatatgagaaaaagatccaagcagaattgtcgaagattgaaagtgattattactataac
agtgtgctgactttattcggccttggctggtatcaagatttatactcttttaatgatgat
ggcagcgttactcctaagtgggttaatgtatgtcagtaa

DBGET integrated database retrieval system