KEGG   Aliivibrio fischeri ES114: VF_A0882Help
Entry
VF_A0882          CDS       T00236                                 

Gene name
bcsZ
Definition
endo-1,4-D-glucanase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
vfi  Aliivibrio fischeri ES114
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vfi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    VF_A0882 (bcsZ)
Enzymes [BR:vfi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     VF_A0882 (bcsZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(996424..997602)
Genome map
AA seq 392 aa AA seqDB search
MKMQLTVLSLLIGTLTCSSSAIAQDENYTTPIVSSAALTKENQCEWGQWESFKQHYIENG
RVVDNSDPRLITTSEGQSYALFFALIANDKKTFDELLGWTELHLAGGDLTAQLPAWLWGR
QPDGSQGILDSNSAADSDLWIAYSLLEAGRLWDNHYYQSLGHLLASRILRDETIKVSGLG
TVLLPGKVGFVLGKNHVRLNPSYVPLQLLTRMNTVFPSYQWEEIYQSSAKLLKETMPKGY
SPDWVEWDKTQFKKDSKTQSVGSYNAIRVYLWAGMLPDSDPNKALLLDKMKPLVRVIERN
KGMPETINVLTGKGKNQGGVGMNAAILPLLSSLDSNTNAVEYEKKIQAELSKIESDYYYN
SVLTLFGLGWYQDLYSFNDDGSVTPKWVNVCQ
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatgcaattaacggtattgagtctattaattggcacgttaacttgctcttcttca
gctattgctcaagatgaaaattacacaaccccaatcgtttcatctgccgcactaacaaaa
gagaatcagtgtgaatgggggcaatgggaaagctttaaacaacattatatagagaatggt
cgagtcgttgataacagtgatcctcgtttaataacgacatcagaaggtcaatcttatgct
ctattttttgcattaattgcgaatgataaaaaaacatttgatgaattacttggttggact
gagttgcatttagctgggggggatctaacagcacaactccctgcttggttatggggaagg
caacctgatggctcgcaaggtattttagactcaaactcagcagctgactcagatttatgg
attgcttatagtctactcgaagccggaagattgtgggataaccattattatcaatctctt
ggacatttactggctagtcgaattttacgtgacgaaaccatcaaagtgtcaggtcttgga
acggtattattgccaggaaaagtgggatttgtattgggtaaaaatcatgttcgattaaac
ccaagctacgtcccattgcagttgctaactcgaatgaatacggttttccctagctaccaa
tgggaagaaatatatcaatcaagcgcaaaattactaaaagaaaccatgccaaaaggctat
agtcctgattgggttgagtgggataaaactcaatttaaaaaagattcaaagacccaaagt
gttggcagctataatgcgattagagtgtatttatgggcaggaatgctaccagatagcgac
cctaataaagcattgttacttgataaaatgaagccattagttcgtgttatagaaagaaat
aaaggcatgcctgagacaataaatgtgctaacaggaaaaggtaaaaatcaaggtggcgtc
ggaatgaacgcagctattttgcctttattatcttcgttagattcaaatacaaatgccgtt
gaatatgagaaaaagatccaagcagaattgtcgaagattgaaagtgattattactataac
agtgtgctgactttattcggccttggctggtatcaagatttatactcttttaatgatgat
ggcagcgttactcctaagtgggttaatgtatgtcagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system