KEGG   Vibrio furnissii: vfu_A02880Help
Entry
vfu_A02880        CDS       T01680                                 

Definition
(GenBank) thymidine phosphorylase
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
vfu  Vibrio furnissii
Pathway
vfu00240  Pyrimidine metabolism
vfu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vfu00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    vfu_A02880
Enzymes [BR:vfu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     vfu_A02880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 PYNP_C Glycos_trans_3N Gloverin
Motif
Other DBs
NCBI-ProteinID: ADT87992
UniProt: F0LW53
Position
1:complement(2998787..3000115)
Genome map
AA seq 442 aa AA seqDB search
MYLPQEIIRRKRDGEVLTAEEINFFIQGVANNTVSEGQIAAFAMAVFFREMTMPERIALT
CAMRDSGMVIDWSHMNFDGPIVDKHSTGGVGDVTSLMLGPMVAACGGYVPMISGRGLGHT
GGTLDKLESIPGYNITPTNDVFGKVTKEAGVAIIGQTGDLAPADKRVYATRDITATVDNI
SLITASILSKKLAAGLESLVMDVKVGSGAFMPTYEASEELAKSIVAVANGAGTKTTAILT
DMNQVLASSAGNAVEVREAVRFLTGEYRNPRLFEVTMASCAEMLVLGKLAQDTTDARAKL
QAVLDNGQAAEHFGKMVAGLGGPADFVANYDNYLDKAEIIKPVYAEQSGVVSAMDTRAIG
MAVVGMGGGRRVATDKIDYAVGFDQFIRLGEVADSNKPLAMIHARTETQWQDAANALQRA
IKVGGEYVPTPEVYRQIREEDV
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgtatttacctcaagaaattattcgcagaaaacgtgatggggaagtcctaaccgcagaa
gagatcaacttctttattcagggtgtcgcaaacaatacggtttctgaaggccaaatcgca
gcctttgcgatggcggtgttctttcgtgaaatgaccatgccagaacggattgcgctgact
tgtgcaatgcgcgattccggcatggtgatcgactggagccacatgaattttgatggcccg
atcgtcgacaaacactccactggcggtgtgggcgatgtgacctcactgatgcttggccca
atggtggcagcatgtggggggtacgtgccgatgatctctggccgtggccttggccacacc
ggtggtacgctggataaactggaatcgattccaggctacaacattaccccaaccaacgac
gtgttcggcaaagtcaccaaagaggctggcgtggccatcatcggtcaaaccggcgatttg
gcccccgcggataaacgtgtttacgcgacgcgtgatatcaccgccaccgtcgacaatatt
tcgctcatcacggcttccattttgtctaaaaaattagcggcaggtttggaatcgctggtg
atggacgtcaaggtgggttctggcgcgttcatgccgacttacgaagcgtcggaagagctg
gcgaaatctatcgtggctgtggccaacggtgcgggcaccaaaaccaccgcaattctgacc
gatatgaaccaagtgttggcttcatcggcggggaatgccgtggaagtgcgcgaagcggtg
cgcttcctcactggggaataccgtaacccacgcttgtttgaagtgaccatggcgtcgtgc
gctgaaatgctggtgctgggtaaattggcccaagacaccaccgatgcgcgcgccaaactg
caagcggtgttggataacggccaagcggcggaacactttggcaaaatggtggccggtctt
ggtggccctgctgattttgtggcgaactacgacaactacctcgacaaagcagagatcatt
aaacctgtctatgccgagcaaagcggcgtggtgtctgcgatggacacgcgcgcgatcggt
atggcggtggtcggcatgggcggcggacgccgtgtggcgacagacaagatcgattacgcg
gtcggctttgaccagtttattcgtctgggtgaggtggccgacagcaataaacctttagca
atgattcacgcccgcacggaaacgcagtggcaagacgctgccaacgcattacaacgtgca
attaaagtgggcggagagtatgtaccaactccggaagtgtaccgtcagattcgtgaagaa
gacgtgtag

DBGET integrated database retrieval system