KEGG   Vibrio furnissii: vfu_A02880Help
Entry
vfu_A02880        CDS       T01680                                 

Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
vfu  Vibrio furnissii
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vfu00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    vfu_A02880
Enzymes [BR:vfu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     vfu_A02880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2998787..3000115)
Genome map
AA seq 442 aa AA seqDB search
MYLPQEIIRRKRDGEVLTAEEINFFIQGVANNTVSEGQIAAFAMAVFFREMTMPERIALT
CAMRDSGMVIDWSHMNFDGPIVDKHSTGGVGDVTSLMLGPMVAACGGYVPMISGRGLGHT
GGTLDKLESIPGYNITPTNDVFGKVTKEAGVAIIGQTGDLAPADKRVYATRDITATVDNI
SLITASILSKKLAAGLESLVMDVKVGSGAFMPTYEASEELAKSIVAVANGAGTKTTAILT
DMNQVLASSAGNAVEVREAVRFLTGEYRNPRLFEVTMASCAEMLVLGKLAQDTTDARAKL
QAVLDNGQAAEHFGKMVAGLGGPADFVANYDNYLDKAEIIKPVYAEQSGVVSAMDTRAIG
MAVVGMGGGRRVATDKIDYAVGFDQFIRLGEVADSNKPLAMIHARTETQWQDAANALQRA
IKVGGEYVPTPEVYRQIREEDV
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgtatttacctcaagaaattattcgcagaaaacgtgatggggaagtcctaaccgcagaa
gagatcaacttctttattcagggtgtcgcaaacaatacggtttctgaaggccaaatcgca
gcctttgcgatggcggtgttctttcgtgaaatgaccatgccagaacggattgcgctgact
tgtgcaatgcgcgattccggcatggtgatcgactggagccacatgaattttgatggcccg
atcgtcgacaaacactccactggcggtgtgggcgatgtgacctcactgatgcttggccca
atggtggcagcatgtggggggtacgtgccgatgatctctggccgtggccttggccacacc
ggtggtacgctggataaactggaatcgattccaggctacaacattaccccaaccaacgac
gtgttcggcaaagtcaccaaagaggctggcgtggccatcatcggtcaaaccggcgatttg
gcccccgcggataaacgtgtttacgcgacgcgtgatatcaccgccaccgtcgacaatatt
tcgctcatcacggcttccattttgtctaaaaaattagcggcaggtttggaatcgctggtg
atggacgtcaaggtgggttctggcgcgttcatgccgacttacgaagcgtcggaagagctg
gcgaaatctatcgtggctgtggccaacggtgcgggcaccaaaaccaccgcaattctgacc
gatatgaaccaagtgttggcttcatcggcggggaatgccgtggaagtgcgcgaagcggtg
cgcttcctcactggggaataccgtaacccacgcttgtttgaagtgaccatggcgtcgtgc
gctgaaatgctggtgctgggtaaattggcccaagacaccaccgatgcgcgcgccaaactg
caagcggtgttggataacggccaagcggcggaacactttggcaaaatggtggccggtctt
ggtggccctgctgattttgtggcgaactacgacaactacctcgacaaagcagagatcatt
aaacctgtctatgccgagcaaagcggcgtggtgtctgcgatggacacgcgcgcgatcggt
atggcggtggtcggcatgggcggcggacgccgtgtggcgacagacaagatcgattacgcg
gtcggctttgaccagtttattcgtctgggtgaggtggccgacagcaataaacctttagca
atgattcacgcccgcacggaaacgcagtggcaagacgctgccaacgcattacaacgtgca
attaaagtgggcggagagtatgtaccaactccggaagtgtaccgtcagattcgtgaagaa
gacgtgtag

DBGET integrated database retrieval system