KEGG   Vibrio parahaemolyticus BB22OP: VPBB_2168Help
Entry
VPBB_2168         CDS       T02409                                 

Definition
RecD-like DNA helicase YrrC
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
vpb  Vibrio parahaemolyticus BB22OP
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:vpb00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    VPBB_2168
Enzymes [BR:vpb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     VPBB_2168
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2409960..2412065)
Genome map
AA seq 701 aa AA seqDB search
MNTAIHEDQMRVTSIPYSTRGCVIFSGVPLAKDSHRTNSGKYYYVTIKADPDSIPVHPAL
GQHWSVKGIRSIKAIKTGDYVMQQHTYESPSYVECSLPDTGEQLIRFIAKENDFKGIGES
KARALWQLLGADFHDTLTNDTPESRERLISILSDDSVDALFKGYAKYKNLAHCNWMSEHN
IPASVQQRLLKHHGEASIDIIKSNPYSLIGFGLSFGVVEDIIKATDFKSDLTQTDPRRLS
AALEMAIRKEIEKGHTYTTNSQVRPYLNKLLKEKELVAKAFKAGHDKAQYILNPDTGTYH
PTAQLLMESVVAKRLKKLAKCNNLYDENANAAYCSAVSELPYELTSKQIEAVTTCLDNSV
SCITGGAGTGKTTVLRTALRAYHQMGFEIHAVALSGRAAMRLHESIGFVTSTIARLLREN
PIEPSVDKPNYLLVIDEASMIDLPTMYRLVNHTHPSVRLMFIGDPDQLPPIGCGKVLADI
VEAKTVANTMLDIVKRQEGSTGIPEYSKLINQGVVPDQLSMGSIHFHETSKEDIAKVCCE
LYKQHPENSRVMAPTKALVKDINQLIQEAVNPSKDALEFQINGDKFFLPLRLNDAVLFTQ
NHYEIGVQNGSLGTLISVKSTGESYGEVELDTGEKVEVTQSVLDCMELGYAITLHKDQPP
GHNSRASSLPCKKAGYLIELGSIRRLRGQKVKFILLAVVMI
NT seq 2106 nt NT seq  +upstreamnt  +downstreamnt
atgaatacagcaatacatgaagatcagatgcgcgtgaccagcatcccgtatagcactagg
ggatgtgtgattttcagcggtgtaccgctggcgaaagactctcacagaactaatagcggc
aagtactactacgtcaccataaaagccgaccctgacagcattcccgtgcacccagcactc
ggccaacattggtcagttaaggggattcgctcaataaaagccattaaaactggtgattat
gtgatgcagcagcatacctatgagtcacctagttatgttgagtgctctctccccgacacg
ggcgagcaactaatccgttttatcgcaaaagaaaatgacttcaaaggtattggtgaaagc
aaagcgagggcgctctggcagctattaggtgcggattttcatgatacattgacgaatgac
actcctgagtccagagagcgcctgatatcgattctgagtgacgattctgtggacgccctt
tttaagggctacgccaaatacaaaaatctggcacattgcaactggatgagcgaacacaac
atccccgccagtgtgcagcaacggctgctcaaacatcatggagaagcctccatcgatatt
atcaagagtaacccttacagcctcattggctttggtctttcattcggtgtcgttgaagac
attattaaagcaacggattttaagagcgatttgacacaaactgatccaaggagactgagc
gccgcgctagaaatggcgattcgcaaggaaatagaaaaaggtcatacttatacgactaat
tcgcaggtgcgaccctacctgaacaaactgctcaaagaaaaagagttggtcgcaaaggca
ttcaaggcaggtcatgataaagctcaatacattctgaaccccgacacaggaacctatcat
ccaaccgcccaattgctcatggagagtgttgttgcaaagcggctcaaaaaactggctaag
tgcaacaacctgtatgacgaaaacgctaatgccgcctactgctcggctgtttcagaactt
ccttatgaattaacctcaaagcaaattgaagccgtaacaacgtgtctagacaattcggta
agctgcattacaggcggtgcaggaacaggcaagacaacggtacttagaacggctctcagg
gcttaccatcaaatgggttttgaaattcacgccgtcgcgctcagtggtcgtgctgcaatg
aggctccatgagtccatcggttttgttacctcaaccattgccagattgctgcgtgaaaac
cctattgaacccagtgtagataaaccaaattacctactggtgattgatgaggcaagtatg
attgatttaccaaccatgtatcgccttgtcaatcacactcacccttcagtacgattgatg
ttcattggcgatcccgatcagctcccaccgattggctgcggtaaagtgctagcagatatc
gttgaagcaaaaacggtcgccaataccatgctagatattgtcaagagacaagaaggttca
acgggcattcctgaatactccaagctcatcaatcaaggtgtggtgcctgaccaattaagc
atgggttctatacactttcacgaaaccagtaaagaagacatagccaaagtctgttgcgag
ctttacaagcagcaccctgaaaatagtcgtgtaatggctccaactaaagcacttgttaag
gacatcaatcagctaatacaagaagctgtcaacccgagcaaagatgctctggaattccaa
atcaatggagataaattttttttgccacttcgcttgaatgatgcggttctattcacgcaa
aatcattatgagataggcgtccaaaatggctctcttggtacacttatcagcgtgaaatcc
actggcgaaagctatggtgaagtggaacttgatactggtgagaaggtcgaggtgacgcaa
tctgtcctagattgcatggagctgggctatgcaatcaccttgcacaaagatcaacccccg
ggtcacaattcccgcgcatcatcattgccctgcaaaaaggcaggatacttgatagagctt
ggctctatacggcgattacgagggcagaaagtgaaattcatattgttggcagtagtgatg
atatga

DBGET integrated database retrieval system