KEGG   Vanderwaltozyma polyspora: Kpol_1056p36Help
Entry
Kpol_1056p36      CDS       T01049                                 

Definition
hypothetical protein
Orthology
K04709  
Acyl-CoA-dependent ceramide synthase [EC:2.3.1.24]
Organism
vpo  Vanderwaltozyma polyspora
Pathway
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:vpo00600]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 415 aa AA seqDB search
MSENKKGSLSAPVMRNRATSSVGKIDVGDTVPGLGTMDESKASKIAAEERMQRICQGDGD
DMDLMKKIWLSYREMNYRHTWLTPLVLLIIFYSAYITSGNRTESNPLHQFVAVSYQVGDT
DYYGKGIKDLSFIFFYMIFFTFLREFLMDVVIRPITIKKLKITSKHRINRMMEQVYSIIY
CGVSGPFGLYIMYHSDLWLFETKTMYRTYPDLNNTYLYKLFYLGQAAFWAQQACVLVLQL
EKPRKDRRELVFHHIVTLLLIWSSYVFHFTKMGLAIYITMDVSDFFLALSKALNYLEYEY
TPVVFIIFVISWVYLRHIVNIKILWSVLTQFRTEGNYVLNYATQQYKCWISLPIVFILIF
ALQLVNLYWLVLILRILYRAVWKGVQKDERSDSSESDDDDEPAETSSNNDNKKNN
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaaataaaaagggtagtctaagtgcacctgtaatgagaaacagagctacatct
tctgttggcaagattgatgtgggtgataccgttccaggtttaggaaccatggatgaatcc
aaagcatcgaagattgctgctgaagaaagaatgcaaagaatctgccaaggtgatggtgat
gatatggatttaatgaaaaaaatttggttatcttatagagaaatgaattatcgccataca
tggctaacacctttggttcttttaatcatattttatagtgcatatattacttctggcaat
agaactgaaagtaatccattacatcaatttgttgcagtttcttatcaagttggtgacact
gattattatggtaaaggtatcaaagatttatcctttatattcttttacatgatctttttc
acatttctaagagaatttctaatggatgtcgttattcgtccaattacaatcaaaaaactg
aagatcacttcaaaacatagaatcaatagaatgatggagcaagtatattcaattatttac
tgtggtgtctcaggtccattcggtttatatatcatgtaccattcagatttatggttattt
gaaaccaaaacaatgtaccgtacttatccagatttgaataatacttacctttataaatta
ttttatttaggtcaagcagcattttgggctcaacaagcttgtgttttggttctgcaatta
gaaaagccaagaaaggatcgtagagaattggttttccatcatattgtaaccctattgctg
atctggtcatcgtatgttttccatttcactaaaatgggtctagcaatttatattacaatg
gatgtctcagatttctttcttgctttatcaaaagctttgaactatttggaatatgaatat
acccctgttgtatttattattttcgtcatttcttgggtctatttacgtcatattgttaac
attaaaattttatggtcggttttaacacaattccgtactgaaggtaattatgtcctaaat
tatgctacccagcaatataaatgttggatatcgctaccaattgttttcattttgattttt
gcattacaattagtcaacttatactggttggttttgatcttaagaatcttgtatagagca
gtttggaaaggtgttcaaaaagatgaaagaagtgactccagtgaatctgatgatgatgat
gaaccggctgaaacctccagtaacaatgacaacaagaaaaacaattaa

DBGET integrated database retrieval system