KEGG   Vanderwaltozyma polyspora: Kpol_529p3Help
Entry
Kpol_529p3        CDS       T01049                                 

Definition
hypothetical protein
Orthology
K11252  
histone H2B
Organism
vpo  Vanderwaltozyma polyspora
Brite
Exosome [BR:vpo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Kpol_529p3
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 128 aa AA seqDB search
MSAKAEKKPASKAPAAAKKTPTAGGEGKKRTKARKETYSSYIYKVLKQTHPDTGISQKAM
SILNSFVNDIFERIATEASKLAAYNKKSTISAREIQTAVRLILPGELAKHAVSEGTRAVT
KYSSSTQA
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccaaagccgaaaagaaacctgcctccaaagccccagccgctgccaagaagacc
ccaactgccggtggtgaaggtaagaagagaaccaaggccagaaaggaaacatactcatca
tacatctacaaggttttgaaacaaacccatccagacacaggtatttcccaaaaggccatg
tctattttgaattcttttgttaacgatattttcgaaagaattgctactgaagcctccaaa
ttggctgcatacaacaagaagtccaccatctccgccagagaaatccaaactgctgtcaga
ttgatcttgccaggtgaattggccaagcatgctgtttctgaaggtaccagagctgttacc
aaatactcttcatctactcaagcttaa

DBGET integrated database retrieval system