KEGG   Vanderwaltozyma polyspora: Kpol_529p3Help
Entry
Kpol_529p3        CDS       T01049                                 

Definition
(RefSeq) hypothetical protein
  KO
K11252  histone H2B
Organism
vpo  Vanderwaltozyma polyspora
Brite
Chromosome and associated proteins [BR:vpo03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    Kpol_529p3
Exosome [BR:vpo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Kpol_529p3
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa CENP-W YscO-like
Motif
Other DBs
NCBI-GeneID: 5544815
NCBI-ProteinID: XP_001644481
UniProt: A7TM56
AA seq 128 aa AA seqDB search
MSAKAEKKPASKAPAAAKKTPTAGGEGKKRTKARKETYSSYIYKVLKQTHPDTGISQKAM
SILNSFVNDIFERIATEASKLAAYNKKSTISAREIQTAVRLILPGELAKHAVSEGTRAVT
KYSSSTQA
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccaaagccgaaaagaaacctgcctccaaagccccagccgctgccaagaagacc
ccaactgccggtggtgaaggtaagaagagaaccaaggccagaaaggaaacatactcatca
tacatctacaaggttttgaaacaaacccatccagacacaggtatttcccaaaaggccatg
tctattttgaattcttttgttaacgatattttcgaaagaattgctactgaagcctccaaa
ttggctgcatacaacaagaagtccaccatctccgccagagaaatccaaactgctgtcaga
ttgatcttgccaggtgaattggccaagcatgctgtttctgaaggtaccagagctgttacc
aaatactcttcatctactcaagcttaa

DBGET integrated database retrieval system