KEGG   Aliivibrio salmonicida: VSAL_II0050Help
Entry
VSAL_II0050       CDS       T00782                                 

Gene name
chb
Definition
N,N'-diacetylchitobiase (chitobiase) (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
vsa  Aliivibrio salmonicida
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vsa00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    VSAL_II0050 (chb)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    VSAL_II0050 (chb)
Enzymes [BR:vsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     VSAL_II0050 (chb)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(63564..66209)
Genome map
AA seq 881 aa AA seqDB search
MFKKTLLSTLILAGLAACSSTTPEQSTVNLLAENLDVNYTVITNQGADDGLACKDLQAEF
ASCNKVNMTLTNTGAAVDSSDWTIYFHSIRLILDVENDQFKITRVTGDLHKLEPTDKFDG
FAAGEEVVIPLVAEYWQLFETDFMPGAFVTAPGAEARNIISLDTEDTGEYVDEIIGVQLK
RTLADNNVTATANTRFEKNSDVAEVDASSHIIPTPLKTTLTNKTVDLAKGISITANGIDA
DQLAALNQRAELLGLETAGEYPVSVAVDKSQFKDGVSGAYTLDVTEGKTTVVAFDEAGAF
YGVQSLLALVSLDSSEIPTLNVEDAPRFEYRGVMVDVARNFHSKEAILATVDQMAAYKLN
KLHLHLTDDEGWRLEIPGLPELTDIGSNRCFDESETSCLLPQLGSGADSDNFGSGFFTTE
DYLEILTYAKNRNIEVIPEIDMPAHSRAAVMSMEARYTRLAAEGKMEEANEYRLMDPKDE
SNVTTVQFYNKQSFINPCLDSSATFVDKVITEVAAMHKAAGVPLSTWHFGGDEAKNIKLH
AGFQDINDEEKIGWKGDLDLSKQDFPFAKSPQCQSLIASGEVADFEHLPSHFAEQVSKIA
AKQGIPHFQAWQDGLKHSEGADAFATESVRANFWDTLYWGGGASAYEWADKGYDVVVSSP
DYVYMDFPYEVDAKERGYYWATRATDTRKMFGFAPENLPQNAETSVDRDGNGFESAGTVT
PKKPFYGLSAQLWSETVRTDEQYEYMVFPRVIAAAERAWHEASWENEYKAGVKYSLDTNL
VNKKAQLADWTNFANTMGQRELAKLERAGIDYRLPIPGAEIANGELSMNISFPGVTLQYS
VDGGKTWAAYDNANKPKVTGDVQIRSASFTGERVSRVTSVK
NT seq 2646 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaaaaacgcttttatcgacccttatccttgcaggcttagcggcatgttcatca
acaacgccagagcaatcaacagttaacctattggctgaaaatctagatgttaactacaca
gttattactaaccaaggtgctgatgacggccttgcttgtaaagatcttcaagctgaattt
gcatcatgtaacaaagtaaacatgacgctaaccaatacaggtgctgcggttgattcaagt
gattggacaatctatttccacagcattcgtttaattctagatgttgaaaatgaccaattt
aaaattactcgtgtaacgggtgacttacataaacttgaaccaacagataaatttgatggt
tttgctgctggtgaagaagtcgttattccactggttgctgaatattggcagttatttgaa
actgacttcatgccgggcgcattcgtaacagcaccaggtgcagaagctcgtaatattatt
tctttagatactgaagacactggtgaatacgtagatgaaattatcggtgttcaactaaag
cgtacacttgctgataataacgtaacggcaacagctaatactcgttttgagaaaaactca
gatgtagctgaagtagacgcgtcttctcatattattccaacacctttaaaaacaacgcta
actaataaaaccgttgatttagcaaaaggtatttcaattacagctaacggtattgatgca
gaccaacttgcagcattaaatcaacgtgctgaacttctaggcctagaaacggcgggtgaa
tacccagtatcagtagcggttgataagagccaatttaaagatggcgtatctggcgcatac
acactagatgtcactgaaggtaaaacaacggttgttgcatttgatgaagcgggtgcattc
tacggcgttcaatctttactagcactagtaagcctagatagctcagaaatcccaacacta
aacgtggaagatgctcctcgttttgaataccgtggtgtaatggttgatgttgctcgtaac
ttccactcaaaagaagcgattcttgcgacagttgaccaaatggcagcctacaaacttaac
aaactacaccttcacctaacagatgatgaaggctggcgtttagagatccctggtcttcct
gaactaactgacatcggtagtaatcgttgttttgatgagtcagaaacatcatgtctacta
cctcaactaggttcaggtgctgattcagataactttggttctggtttcttcacaacagaa
gattacctagagatcctaacgtacgctaaaaaccgtaacattgaagtgattccagaaatc
gatatgccagctcactcacgtgcagcagtaatgtcaatggaagcgcgttacactcgtctt
gctgctgaaggcaagatggaagaagcaaacgaatatcgtctgatggatccaaaagacgaa
tcaaacgtaacaacggttcagttctacaacaaacaaagtttcatcaacccatgtttagat
tcatcggcaacgttcgtagataaagtcatcactgaagttgctgcaatgcacaaagcggct
ggtgttcctttatcaacatggcacttcggtggtgatgaagcgaaaaacatcaaacttcac
gctggtttccaagacatcaatgatgaagaaaaaatcggatggaaaggtgacttagaccta
tctaaacaagatttcccatttgctaaatcaccacaatgtcagtctttgattgcaagcggt
gaagttgcagatttcgaacacctgccaagccattttgctgagcaagtatcgaaaatcgca
gctaaacaaggcattccacacttccaagcatggcaagatggcttgaaacactctgaaggc
gctgatgcatttgcaactgaatctgtacgtgcaaacttctgggatactctgtactggggc
ggcggtgcttcagcatacgaatgggcagataaaggctatgacgtagttgtttctagtcct
gattatgtttacatggatttcccatacgaagttgatgcgaaagagcgtggctactactgg
gcaactcgtgcaacagatactcgtaagatgttcggtttcgcaccagaaaacctacctcaa
aatgcggaaacatccgttgaccgtgacggtaacggctttgaaagtgcgggcacagtaaca
ccgaagaaacctttctacggtttgtctgcgcaactttggtctgagacagtacgtactgat
gagcaatatgagtacatggtattcccacgtgtcattgcagcagcagagcgtgcatggcat
gaagcgtcttgggaaaatgaatacaaagcaggtgttaaatactctctagatacaaaccta
gtgaacaagaaagcacagcttgctgattggacgaactttgcaaacactatgggtcaacgt
gaattagcgaagcttgaaagagcgggtattgattatcgtctaccaatcccaggtgcagaa
attgcaaacggcgagctaagcatgaacatttcattcccaggtgtaacgctacaatactct
gtagatggcggtaaaacatgggctgcatatgacaatgcgaacaaaccaaaagtaactggt
gatgttcaaattcgttcagcatcatttactggcgagcgtgttagccgagtaactagcgtt
aaataa

DBGET integrated database retrieval system