KEGG   Wolbachia wBm (Brugia malayi): Wbm0485Help
Entry
Wbm0485           CDS       T00234                                 

Definition
(GenBank) Succinate dehydrogenase subunit D sdhD, hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
wbm  Wolbachia wBm (Brugia malayi)
Pathway
wbm00020  Citrate cycle (TCA cycle)
wbm00190  Oxidative phosphorylation
wbm00650  Butanoate metabolism
wbm01100  Metabolic pathways
wbm01110  Biosynthesis of secondary metabolites
wbm01120  Microbial metabolism in diverse environments
wbm01130  Biosynthesis of antibiotics
wbm01200  Carbon metabolism
Module
wbm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
wbm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
wbm_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:wbm00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Wbm0485
   00650 Butanoate metabolism
    Wbm0485
  Energy metabolism
   00190 Oxidative phosphorylation
    Wbm0485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt
Motif
Other DBs
NCBI-ProteinID: AAW71073
UniProt: Q5GSF1
Position
complement(633727..634092)
Genome map
AA seq 121 aa AA seqDB search
MNQSGNAVHYWWVHRISAVILLFLLPWFIYSFSYAFYANNSLSFNEKLFQAINHPLDLLF
FVVLLFCIFWHAVLGMQVVCEDYIHSIPLRIFTITCIKYLSSITYIVLAFTIFFFYKHVF
L
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaatctggaaatgcagtacattattggtgggttcatcgtatttctgcggtaatt
ttactatttttacttccttggtttatctattcattttcttacgcattttatgctaataat
tctttatcttttaatgaaaaattatttcaggctattaatcaccccctagatcttctattt
tttgttgtattgctgttttgtattttttggcacgcagttcttggaatgcaggtagtgtgt
gaagattatatacacagtatacctctaaggatttttacaattacatgtataaagtatttg
tcaagcatcacttatatagttcttgcctttacaatttttttcttttataagcatgttttc
ttataa

DBGET integrated database retrieval system