KEGG   Wolbachia wBm (Brugia malayi): Wbm0485Help
Entry
Wbm0485           CDS       T00234                                 

Definition
succinate dehydrogenase subunit D sdhD, hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
wbm  Wolbachia wBm (Brugia malayi)
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:wbm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Wbm0485
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Wbm0485
   00650 Butanoate metabolism
    Wbm0485
  Energy metabolism
   00190 Oxidative phosphorylation
    Wbm0485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(633727..634092)
Genome map
AA seq 121 aa AA seqDB search
MNQSGNAVHYWWVHRISAVILLFLLPWFIYSFSYAFYANNSLSFNEKLFQAINHPLDLLF
FVVLLFCIFWHAVLGMQVVCEDYIHSIPLRIFTITCIKYLSSITYIVLAFTIFFFYKHVF
L
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaatctggaaatgcagtacattattggtgggttcatcgtatttctgcggtaatt
ttactatttttacttccttggtttatctattcattttcttacgcattttatgctaataat
tctttatcttttaatgaaaaattatttcaggctattaatcaccccctagatcttctattt
tttgttgtattgctgttttgtattttttggcacgcagttcttggaatgcaggtagtgtgt
gaagattatatacacagtatacctctaaggatttttacaattacatgtataaagtatttg
tcaagcatcacttatatagttcttgcctttacaatttttttcttttataagcatgttttc
ttataa

DBGET integrated database retrieval system