KEGG   Wigglesworthia glossinidia morsitans (Glossina morsitans): WIGMOR_0511Help
Entry
WIGMOR_0511       CDS       T01747                                 

Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
wgl  Wigglesworthia glossinidia morsitans (Glossina morsitans)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:wgl00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    WIGMOR_0511
Enzymes [BR:wgl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     WIGMOR_0511
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(524972..526807)
Genome map
AA seq 611 aa AA seqDB search
MKIIKKIFLKLQKIEVLNSLDIQFSLSINIEKEPYLILASAFLSAENRLGNSYLSLYTLK
KLFKKHELDILWEVHGKVNTIKQWENKLFQSKIVGHFFNYRPIVLFKQKLYLYNTWKNEV
NFKKFLYTRFYFPCSNKKNKIIFNFFNKYITNKKNNFWKIQSILNICNYSPAWILGEKAL
NKKYFIFDILSIFLELNSTNYCHLILVTLNKRSLVFFNKQIRYLKKKYLKNNFSINCIVL
YELLNSYYYNQDFVSYRYYPIYCDFMIIYDISMINLSVINDIINVYKKNTSKIVFIGNHS
NFKNIEKGSILSQIYTYCKNSKKLFYKPKFTKILNENIFSIEKLNTPAIINNLGNILIIK
NFKKHKICPNINYLAKLIKIKYSHEILSFINKNIYKGVKYVLLKNQLDCQDMINKIFLNY
VKFFNKIKKNFHNINYILNYSVTKFRVICTSKYNYLGVYKLNYIIENMLKNYLFYKYNLS
IKRNLYTGRLVISKIDYSLLDIYKNDIGIIIENYPKSYVYFYKNKKFKKFNCNMFVNLQP
AFILYIKDFLDLSITLDNAIILLSHSISSNIAHEFLYTTLLQVRKKVIIYDFNNSLKRSF
LHSAYKKVGIL
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattatcaaaaaaatttttttaaaattacaaaaaattgaagtattaaattcttta
gacatacaattttcattatccattaatatagaaaaagaaccttatttaattttagctagc
gcttttttaagcgcagaaaacagattaggaaattcttatttatctttatatactttaaaa
aaattatttaaaaaacatgaactagatatactatgggaagtacatggaaaagtaaatact
ataaaacaatgggaaaataaactttttcaatcgaaaatagttggtcatttttttaattac
agacctattgttttatttaaacaaaaattatatttatataatacatggaaaaatgaagta
aattttaaaaaatttttatatactcgtttttattttccatgtagtaataaaaaaaataaa
ataattttcaatttttttaataaatatataactaataaaaaaaataatttttggaaaatt
caatcgattttgaatatatgcaattatagtcctgcatggatattaggagaaaaagcactt
aataaaaaatattttatttttgatattttatcaatttttttagaattaaattctacaaac
tattgtcatttaatattagtaactttaaataaaagatctttagttttttttaataaacaa
ataagatacttaaaaaaaaaatatttaaaaaataatttttctataaattgtattgtgctt
tatgaattattaaattcatattattacaatcaagattttgtttcttatcgttactatcct
atatattgtgattttatgattatttatgatatttctatgattaatttatccgttatcaat
gatattattaacgtatataaaaaaaatacaagcaaaattgtatttattggaaatcattct
aattttaaaaatatagaaaaaggatcaattctctctcaaatatatacatactgtaaaaat
tcaaaaaaattattttataaaccaaaatttactaaaatattaaatgaaaacatattttct
atagaaaaattaaatactcctgctattataaataatttaggtaatatattaataattaag
aactttaaaaagcacaaaatatgtcctaacattaactatttagcaaaattaattaaaatt
aaatattctcatgaaattttgagttttataaacaaaaatatctataaaggtgttaaatat
gttcttttaaaaaatcaattagattgtcaagatatgataaataaaatttttttaaattat
gttaaattttttaataaaattaaaaaaaattttcataatataaattatattttaaattat
tcagtaacaaaatttagagtaatctgcacatctaaatataattatttgggagtatataaa
ttaaattatattattgaaaatatgttgaaaaattatttattttacaaatataatttatcg
ataaaacgtaacttatatacaggaagattagtaatatctaaaatagattattctttgcta
gatatatataaaaatgatattgggattataattgaaaattatccaaaaagttatgtatat
ttttataaaaacaaaaaatttaaaaaatttaattgcaatatgtttgtaaatttgcaacct
gcatttattttgtacataaaagattttttagacttatctattactctagataatgctatc
atactactctcacattccatttcatctaacattgctcatgaatttttatatacaacttta
ttgcaagttagaaaaaaagttatcatatatgactttaataattctttgaagagatctttt
ttacattctgcatataaaaaagttggtatcttataa

DBGET integrated database retrieval system