KEGG   Xanthomonas campestris pv. campestris 8004: XC_1982Help
Entry
XC_1982           CDS       T00247                                 

Definition
succinate dehydrogenase membrane anchor subunit
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:xcb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    XC_1982
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    XC_1982
   00650 Butanoate metabolism
    XC_1982
  Energy metabolism
   00190 Oxidative phosphorylation
    XC_1982
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2394325..2394711
Genome map
AA seq 128 aa AA seqDB search
MSRYRTPLKNVRGLGAAKTGTEHFVVQRLTATALVPLSIWFLILVLSLIGADHTAASAAV
AKPWNAILLVGFLIASFWHAQLGMQVVLEDYVHNSLLALAAQTLVRFVAVLGAIVSVFAV
ARIALGIA
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgagccgctatagaaccccgttgaagaacgtgcgcggcctgggcgccgccaagaccggc
accgagcatttcgtggtgcagcgtctgaccgccaccgcgctggtgccgctgtcgatctgg
ttcctgatcttagtgttgagcctgatcggtgccgaccacacagcggcgagcgccgcggtt
gccaagccgtggaacgcgatcctgctggtgggcttcctcatcgcctcgttctggcatgcg
cagctcggcatgcaggtggtgctggaggattacgtgcacaactcgctgctcgcccttgcg
gcgcagaccctcgtgcgctttgtcgccgttctcggtgccatcgtcagcgtgtttgccgtg
gcgcgtatcgcgctaggcatcgcctga

DBGET integrated database retrieval system