KEGG   Xanthomonas campestris pv. campestris ATCC 33913: XCC3025Help
Entry
XCC3025           CDS       T00083                                 

Gene name
ruvA
Definition
(RefSeq) Holliday junction DNA helicase RuvA
  KO
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
xcc  Xanthomonas campestris pv. campestris ATCC 33913
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:xcc00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    XCC3025 (ruvA)
Enzymes [BR:xcc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     XCC3025 (ruvA)
DNA repair and recombination proteins [BR:xcc03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     XCC3025 (ruvA)
    RecFOR pathway proteins
     XCC3025 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
complement(3572231..3572815)
Genome map
AA seq 194 aa AA seqDB search
MIGRLRGILAYKQPPWLVIDVGGVGYELEAPMSTFYDLPDVGRDVILFTHYAQKEDSVSL
YGFLREGERRLFRDVQKVTGIGAKIALAVLSGVTVDEFARLITSGDITALTRIPGIGKKT
AERMVVELRDRAADFSSGAPITGQLGPDAVSEATVALQQLGYKPAEAARMAREAGAEGDE
VATVIRKALQAALR
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgatcggccgtctgcgcgggatcctggcctacaagcagccgccgtggctggtgatcgac
gtgggcggggtgggctatgaactggaggcgccgatgagcaccttctacgacctgcccgat
gtcggccgcgacgtcatcctgttcacccattacgcgcagaaggaagacagcgtgtcgctg
tacggcttcctgcgcgagggcgagcgccggctgttccgcgacgtgcagaaggtcaccggc
atcggtgccaagattgcgctggcggtgctgtccggggtcaccgtggacgaattcgcgcgg
ctgatcaccagtggcgacatcactgcgctgacccgcatccccggcatcggcaaaaagacc
gccgagcgcatggtggtggagctgcgcgaccgcgcggccgacttcagcagcggcgcgccg
atcaccggccagctgggcccggatgcggtgtccgaggccaccgtggcgttgcagcagctg
ggctacaagcccgccgaggccgcgcgcatggcacgcgaggccggggccgaaggcgacgag
gtcgccaccgttattcgcaaggccctccaggccgcgctgcgctag

DBGET integrated database retrieval system