KEGG   Xanthomonas campestris pv. campestris ATCC 33913: XCC3025Help
Entry
XCC3025           CDS       T00083                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
xcc  Xanthomonas campestris pv. campestris ATCC 33913
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:xcc00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    XCC3025 (ruvA)
Enzymes [BR:xcc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     XCC3025 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3572231..3572815)
Genome map
AA seq 194 aa AA seqDB search
MIGRLRGILAYKQPPWLVIDVGGVGYELEAPMSTFYDLPDVGRDVILFTHYAQKEDSVSL
YGFLREGERRLFRDVQKVTGIGAKIALAVLSGVTVDEFARLITSGDITALTRIPGIGKKT
AERMVVELRDRAADFSSGAPITGQLGPDAVSEATVALQQLGYKPAEAARMAREAGAEGDE
VATVIRKALQAALR
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgatcggccgtctgcgcgggatcctggcctacaagcagccgccgtggctggtgatcgac
gtgggcggggtgggctatgaactggaggcgccgatgagcaccttctacgacctgcccgat
gtcggccgcgacgtcatcctgttcacccattacgcgcagaaggaagacagcgtgtcgctg
tacggcttcctgcgcgagggcgagcgccggctgttccgcgacgtgcagaaggtcaccggc
atcggtgccaagattgcgctggcggtgctgtccggggtcaccgtggacgaattcgcgcgg
ctgatcaccagtggcgacatcactgcgctgacccgcatccccggcatcggcaaaaagacc
gccgagcgcatggtggtggagctgcgcgaccgcgcggccgacttcagcagcggcgcgccg
atcaccggccagctgggcccggatgcggtgtccgaggccaccgtggcgttgcagcagctg
ggctacaagcccgccgaggccgcgcgcatggcacgcgaggccggggccgaaggcgacgag
gtcgccaccgttattcgcaaggccctccaggccgcgctgcgctag

DBGET integrated database retrieval system