KEGG   Xanthomonas campestris pv. campestris ATCC 33913: XCC4115Help
Entry
XCC4115           CDS       T00083                                 

Gene name
xynA
Definition
endo-1,4-beta-xylanase A
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
xcc  Xanthomonas campestris pv. campestris ATCC 33913
Brite
Enzymes [BR:xcc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     XCC4115 (xynA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4895164..4896321)
Genome map
AA seq 385 aa AA seqDB search
MLLGLLGMAVSPIASAACAPGTTALKDAYAGGFLIGTAVNTDIVSGKDAASAALVGCHFN
AVTAENVMKAEVVAPQPGVFDFTAADAFVADRQRRGMFIVGHTLVWHNQTPEWFFVDANG
KPNTSQAQLERMRAHIARVAGRYVGKVQAWDVVNEIIDEDGSYRSTNWVQRVGDGDTVVR
NAFAFAQRYAPDAQLYYNDFNAWRPAKRDGIVRMVKMLQQAGIRIDGVGMQGHWGLNYPS
VQDIEAAIDAYAALGVKVMITELDIDVLPVTKEGQVIGTGFAHKQFQLPEFKHFLDPYPD
GLPPQVQTQLRDRYAELFALFWRKRDKLARVSVWGVSDGMSWKNDYPVPGRTNYPLLFDR
NHQPKPALDAVLAVPAGASGKQAEG
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgttgctgggcttgctcggcatggccgtctcgcccatcgcctcggcggcctgcgcaccg
ggcaccacggcgctcaaggacgcgtatgcaggcggctttctgatcggcaccgcggtcaat
acggacatcgtctctggcaaggatgcggcctccgcagcgctggttggctgccacttcaac
gcggtgaccgccgagaacgtgatgaaggccgaggtggtggcgccgcagccgggcgtgttc
gatttcaccgcggccgatgcctttgtcgccgacaggcagcggcgtggcatgttcatcgtt
ggccatacgttggtctggcataaccagacgccggagtggttctttgtcgatgcaaacggc
aaaccgaatacgtcgcaggcccaactggaacgcatgcgcgcgcacatcgcgcgcgtggcc
ggccgctacgtgggcaaggtgcaggcctgggacgtggtcaacgagatcatcgacgaggac
ggcagctaccgctccaccaactgggtgcagcgcgtcggcgatggcgacaccgtggtgcgc
aatgcgttcgccttcgcgcagcgctatgcgcccgacgcacagctctactacaacgacttc
aacgcctggcggccggccaagcgcgatggcatcgtgcgcatggtcaagatgctgcagcag
gccggcatccgcatcgacggcgtgggcatgcaagggcattggggcctgaactacccgagc
gtgcaggacatcgaagccgccatcgatgcttacgctgcgctcggggtcaaggtcatgatc
accgagctggacatcgacgtgctgccggtcaccaaggaaggccaggtgatcggcaccggc
tttgcgcacaagcagttccagttacccgaattcaagcacttcctcgacccgtacccggat
ggcctgccaccacaggtgcagacgcagctacgtgaccgctatgcggaactgttcgcgctg
ttctggcgcaagcgcgacaagctggcgcgcgtcagcgtctggggcgtcagcgatggcatg
tcctggaagaacgactaccccgtgcccggccgcaccaactacccgctgctgttcgaccgc
aaccaccagcccaagccggccctggatgcggtgctggcggtgccggcaggcgctagcgga
aagcaagcggagggctga

DBGET integrated database retrieval system