KEGG   Xylanimonas cellulosilytica: Xcel_0389Help
Entry
Xcel_0389         CDS       T01135                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
xce  Xylanimonas cellulosilytica
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:xce00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(457603..459117)
Genome map
AA seq 504 aa AA seqDB search
MPDYVLAIDQGTTSSRAMIFDHGGQVVSTGQLEHDQIFPRAGWVEHNPDQIWNNVREAVG
IALSRANVTYTDIAAVGITNQRETAVVWDKTTGKPVYNAIVWQDTRTQAIVDELGGDVGA
DKYKAIVGLPLATYFSGPKVKWILDNVEGAREAADRGDLLFGNTDSWVLWNMTGGVDGGV
HYTDVTNASRTMLMDLDTLSWREDIASDMGIPLSMLPEIHSSSEVYGKGRQGGLLPGVPI
AGILGDQQAATFGQACFEVGTAKNTYGTGNFMLLNTGTEKVPSKNGLLTTVCYKIGDAPQ
RYALEGSIAVTGSLVQWLRDNLGLFSDAPDVEWLARKVEDNGGAYFVPAFSGLFAPYWRP
DARGALVGLTRYVNKNHIARAALESVAYQTREVLEAMRADSGVELTELKVDGGMVADELL
MQFQADQLGVDVVRPKVAETTALGAAYAAGIAVGYWSGESDVTDNWAEDRRWTPSMDQDE
RERLYRQWKKAVTKTFDWVDVDTQ
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgcctgactacgtactcgccatcgaccagggaaccacgagctcccgggcgatgatcttc
gaccacggcgggcaggtcgtctcgaccggtcagctcgagcacgaccagatcttccccagg
gccggctgggtcgagcacaaccccgaccagatctggaacaacgtgcgcgaggcggtcggc
atcgccctgagccgcgcgaacgtcacctacaccgacatcgcggcggtgggcatcaccaac
cagcgcgagacggcggtggtgtgggacaagaccacgggcaagccggtctacaacgcgatc
gtctggcaggacacccgcacgcaggcgatcgtcgacgagctcggcggcgacgtgggcgcc
gacaagtacaaggcgatcgtcggcctgcccctggccacctacttctccggccccaaggtc
aagtggatcctcgacaacgtcgagggcgctcgcgaggccgcggaccgtggcgacctgctg
ttcggcaacaccgactcgtgggtgctgtggaacatgacgggcggcgtcgacggcggcgtg
cactacacggacgtcaccaacgcgtcgcgcaccatgctgatggacctcgacacgctgtcg
tggcgcgaggacatcgcctccgacatgggcatcccgctgtcgatgctgccggagatccac
tcctcctcggaggtgtacgggaagggccgccagggcgggctgctgccgggcgtgccgatc
gcgggcatcctcggcgaccagcaggccgcgacgttcgggcaggcgtgcttcgaggtcggc
accgcgaagaacacctacggcaccggcaacttcatgctgctcaacacgggcaccgagaag
gtcccgtcgaagaacgggttgctgaccacggtctgctacaagatcggcgacgcaccgcag
cgctacgcgctcgaggggtcgatcgccgtgaccggctcgctcgtgcagtggctgcgggac
aacctggggctattctcggacgcgcccgacgtcgagtggctggcccgcaaggtggaggac
aacggcggcgcctacttcgtgcccgcgttctccggcctgttcgccccctactggcggccg
gacgcccgtggtgccctcgtggggctcacgcggtacgtcaacaagaaccacatcgcacgc
gcggcgctggagtcggtggcgtaccagacccgcgaggtgctcgaggccatgcgcgccgac
tccggcgtcgagctcaccgagctcaaggtcgacggcggcatggtggccgacgagctgctc
atgcagttccaggccgaccagctcggcgtcgacgtcgtgcggcccaaggtggcggagacg
accgcgctcggcgcggcctacgcggcgggcatcgccgtcgggtactggtccggggagtcc
gacgtgaccgacaactgggccgaggaccggcgctggacgccctcgatggaccaggacgag
cgcgagcgcctctaccggcagtggaagaaggcggtgaccaagacgttcgactgggtggac
gtcgacacgcagtag

DBGET integrated database retrieval system