KEGG   Xylanimonas cellulosilytica: Xcel_0389Help
Entry
Xcel_0389         CDS       T01135                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
xce  Xylanimonas cellulosilytica
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xce00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Xcel_0389
Enzymes [BR:xce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Xcel_0389
Exosome [BR:xce04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Xcel_0389
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(457603..459117)
Genome map
AA seq 504 aa AA seqDB search
MPDYVLAIDQGTTSSRAMIFDHGGQVVSTGQLEHDQIFPRAGWVEHNPDQIWNNVREAVG
IALSRANVTYTDIAAVGITNQRETAVVWDKTTGKPVYNAIVWQDTRTQAIVDELGGDVGA
DKYKAIVGLPLATYFSGPKVKWILDNVEGAREAADRGDLLFGNTDSWVLWNMTGGVDGGV
HYTDVTNASRTMLMDLDTLSWREDIASDMGIPLSMLPEIHSSSEVYGKGRQGGLLPGVPI
AGILGDQQAATFGQACFEVGTAKNTYGTGNFMLLNTGTEKVPSKNGLLTTVCYKIGDAPQ
RYALEGSIAVTGSLVQWLRDNLGLFSDAPDVEWLARKVEDNGGAYFVPAFSGLFAPYWRP
DARGALVGLTRYVNKNHIARAALESVAYQTREVLEAMRADSGVELTELKVDGGMVADELL
MQFQADQLGVDVVRPKVAETTALGAAYAAGIAVGYWSGESDVTDNWAEDRRWTPSMDQDE
RERLYRQWKKAVTKTFDWVDVDTQ
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgcctgactacgtactcgccatcgaccagggaaccacgagctcccgggcgatgatcttc
gaccacggcgggcaggtcgtctcgaccggtcagctcgagcacgaccagatcttccccagg
gccggctgggtcgagcacaaccccgaccagatctggaacaacgtgcgcgaggcggtcggc
atcgccctgagccgcgcgaacgtcacctacaccgacatcgcggcggtgggcatcaccaac
cagcgcgagacggcggtggtgtgggacaagaccacgggcaagccggtctacaacgcgatc
gtctggcaggacacccgcacgcaggcgatcgtcgacgagctcggcggcgacgtgggcgcc
gacaagtacaaggcgatcgtcggcctgcccctggccacctacttctccggccccaaggtc
aagtggatcctcgacaacgtcgagggcgctcgcgaggccgcggaccgtggcgacctgctg
ttcggcaacaccgactcgtgggtgctgtggaacatgacgggcggcgtcgacggcggcgtg
cactacacggacgtcaccaacgcgtcgcgcaccatgctgatggacctcgacacgctgtcg
tggcgcgaggacatcgcctccgacatgggcatcccgctgtcgatgctgccggagatccac
tcctcctcggaggtgtacgggaagggccgccagggcgggctgctgccgggcgtgccgatc
gcgggcatcctcggcgaccagcaggccgcgacgttcgggcaggcgtgcttcgaggtcggc
accgcgaagaacacctacggcaccggcaacttcatgctgctcaacacgggcaccgagaag
gtcccgtcgaagaacgggttgctgaccacggtctgctacaagatcggcgacgcaccgcag
cgctacgcgctcgaggggtcgatcgccgtgaccggctcgctcgtgcagtggctgcgggac
aacctggggctattctcggacgcgcccgacgtcgagtggctggcccgcaaggtggaggac
aacggcggcgcctacttcgtgcccgcgttctccggcctgttcgccccctactggcggccg
gacgcccgtggtgccctcgtggggctcacgcggtacgtcaacaagaaccacatcgcacgc
gcggcgctggagtcggtggcgtaccagacccgcgaggtgctcgaggccatgcgcgccgac
tccggcgtcgagctcaccgagctcaaggtcgacggcggcatggtggccgacgagctgctc
atgcagttccaggccgaccagctcggcgtcgacgtcgtgcggcccaaggtggcggagacg
accgcgctcggcgcggcctacgcggcgggcatcgccgtcgggtactggtccggggagtcc
gacgtgaccgacaactgggccgaggaccggcgctggacgccctcgatggaccaggacgag
cgcgagcgcctctaccggcagtggaagaaggcggtgaccaagacgttcgactgggtggac
gtcgacacgcagtag

DBGET integrated database retrieval system