KEGG   Xylanimonas cellulosilytica: Xcel_0758Help
Entry
Xcel_0758         CDS       T01135                                 

Definition
galactokinase
Orthology
K00849  
galactokinase [EC:2.7.1.6]
Organism
xce  Xylanimonas cellulosilytica
Pathway
Galactose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:xce00052]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:xce00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(822800..824089)
Genome map
AA seq 429 aa AA seqDB search
MSVPQWLPAWTRAEGVERVRALFATTFHDDSETGPVDGTADGVWSAPGRVNIIGEHTDYN
EGLCLPTALPHRTYVALEKRDDDVVRIASAQTDEPWTARLTDIHAGGTVEGWGAYVAGVA
WALREAGYPVGGFDAVVDSCVPFGASLSSSAAIECAFAVALSDVFGLGLTGDDTGRTVLV
DAARRAENDIAGAPTGGLDQSASMLCAEDQALLLDFRAGLAPADFAQHVPFDLATAGLNL
LVIDSRAPHQLVDGQYADRRAACDTAAGYLGVQSLREIGLADLDAALTRLTEVDVEDSLR
RRVRHVVTETARTAELAELVRGGLGADGVPDEAAAARAGALMNASHASLRDDYEVTVPET
DLAVDASLAAGAIGARMTGGGFGGSTIALVRADQVEPVAEAVAAAFADAGFTAPAFLAAP
PSAAAGRDA
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtaccgcagtggctgcccgcctggacccgcgccgagggggtcgagcgcgtccgc
gcgctgttcgcgacgacgttccacgacgacagcgagacgggccccgtcgacgggacggcc
gacggcgtctggtcggcccccggccgggtgaacatcatcggcgagcacaccgactacaac
gaagggctgtgcctgcccacggcgctgccgcaccgcacgtacgtcgcgctcgagaagcgt
gacgacgacgtcgtgcgcatcgcctcggcccagaccgacgagccgtggaccgcgcgcctc
acggacatccacgcgggtgggacggtggagggttggggcgcctacgtcgccggggtcgcc
tgggcgctgcgcgaggccggctacccggtcggcgggttcgacgccgtcgtcgactcgtgc
gtgccgttcggggcctcgctgtcgagctccgcggcgatcgagtgcgcgttcgccgtcgcg
ctgtcagacgtcttcgggctgggcctgaccggtgacgacaccggccgcaccgtgctggtc
gacgccgcccggcgcgccgagaacgacatcgcgggcgccccgacgggcgggctcgaccag
tccgcgtcgatgctgtgcgccgaggaccaggcgctgctgctcgacttccgcgccggcctc
gcgcccgccgacttcgcccagcacgtgccgttcgacctcgccacggccggcctgaacctg
ctggtgatcgactcgcgtgccccgcaccagctcgtcgacgggcagtacgccgaccgtcgc
gccgcgtgcgacaccgccgccggctacctcggcgtgcagagcctgagggagatcgggctc
gccgacctggacgcggccctcacgcgcctgaccgaggtcgacgtcgaggacagcctgcgc
cgtcgggtgcggcacgtggtcaccgagacggcccgcaccgccgagctcgcggagctcgtc
cggggcggtctgggcgccgacggcgtccccgacgaggccgccgccgcgcgggcgggggcg
ctcatgaacgcctcgcacgcctcgctgcgcgacgactacgaggtcaccgttcccgagacc
gacctggccgtcgacgcctccctcgcggcgggcgcgatcggcgcccgcatgacgggcggc
gggttcggcggctcgacgatcgcgctggtgcgggccgaccaggtcgagccggtcgccgag
gcggtggccgccgcgttcgccgacgcaggcttcacggcgcccgccttcctggcggccccg
ccgtcggccgccgccggtcgagacgcctga

DBGET integrated database retrieval system