KEGG   Xylanimonas cellulosilytica: Xcel_0758Help
Entry
Xcel_0758         CDS       T01135                                 

Definition
galactokinase
Orthology
K00849  
galactokinase [EC:2.7.1.6]
Organism
xce  Xylanimonas cellulosilytica
Pathway
Galactose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:xce00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Xcel_0758
   00520 Amino sugar and nucleotide sugar metabolism
    Xcel_0758
Enzymes [BR:xce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.6  galactokinase
     Xcel_0758
Exosome [BR:xce04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Xcel_0758
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(822800..824089)
Genome map
AA seq 429 aa AA seqDB search
MSVPQWLPAWTRAEGVERVRALFATTFHDDSETGPVDGTADGVWSAPGRVNIIGEHTDYN
EGLCLPTALPHRTYVALEKRDDDVVRIASAQTDEPWTARLTDIHAGGTVEGWGAYVAGVA
WALREAGYPVGGFDAVVDSCVPFGASLSSSAAIECAFAVALSDVFGLGLTGDDTGRTVLV
DAARRAENDIAGAPTGGLDQSASMLCAEDQALLLDFRAGLAPADFAQHVPFDLATAGLNL
LVIDSRAPHQLVDGQYADRRAACDTAAGYLGVQSLREIGLADLDAALTRLTEVDVEDSLR
RRVRHVVTETARTAELAELVRGGLGADGVPDEAAAARAGALMNASHASLRDDYEVTVPET
DLAVDASLAAGAIGARMTGGGFGGSTIALVRADQVEPVAEAVAAAFADAGFTAPAFLAAP
PSAAAGRDA
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtaccgcagtggctgcccgcctggacccgcgccgagggggtcgagcgcgtccgc
gcgctgttcgcgacgacgttccacgacgacagcgagacgggccccgtcgacgggacggcc
gacggcgtctggtcggcccccggccgggtgaacatcatcggcgagcacaccgactacaac
gaagggctgtgcctgcccacggcgctgccgcaccgcacgtacgtcgcgctcgagaagcgt
gacgacgacgtcgtgcgcatcgcctcggcccagaccgacgagccgtggaccgcgcgcctc
acggacatccacgcgggtgggacggtggagggttggggcgcctacgtcgccggggtcgcc
tgggcgctgcgcgaggccggctacccggtcggcgggttcgacgccgtcgtcgactcgtgc
gtgccgttcggggcctcgctgtcgagctccgcggcgatcgagtgcgcgttcgccgtcgcg
ctgtcagacgtcttcgggctgggcctgaccggtgacgacaccggccgcaccgtgctggtc
gacgccgcccggcgcgccgagaacgacatcgcgggcgccccgacgggcgggctcgaccag
tccgcgtcgatgctgtgcgccgaggaccaggcgctgctgctcgacttccgcgccggcctc
gcgcccgccgacttcgcccagcacgtgccgttcgacctcgccacggccggcctgaacctg
ctggtgatcgactcgcgtgccccgcaccagctcgtcgacgggcagtacgccgaccgtcgc
gccgcgtgcgacaccgccgccggctacctcggcgtgcagagcctgagggagatcgggctc
gccgacctggacgcggccctcacgcgcctgaccgaggtcgacgtcgaggacagcctgcgc
cgtcgggtgcggcacgtggtcaccgagacggcccgcaccgccgagctcgcggagctcgtc
cggggcggtctgggcgccgacggcgtccccgacgaggccgccgccgcgcgggcgggggcg
ctcatgaacgcctcgcacgcctcgctgcgcgacgactacgaggtcaccgttcccgagacc
gacctggccgtcgacgcctccctcgcggcgggcgcgatcggcgcccgcatgacgggcggc
gggttcggcggctcgacgatcgcgctggtgcgggccgaccaggtcgagccggtcgccgag
gcggtggccgccgcgttcgccgacgcaggcttcacggcgcccgccttcctggcggccccg
ccgtcggccgccgccggtcgagacgcctga

DBGET integrated database retrieval system