KEGG   Xanthomonas campestris pv. raphani: XCR_1998Help
Entry
XCR_1998          CDS       T01872                                 

Gene name
xylA
Definition
xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
xcp  Xanthomonas campestris pv. raphani
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xcp00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    XCR_1998 (xylA)
   00051 Fructose and mannose metabolism
    XCR_1998 (xylA)
Enzymes [BR:xcp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     XCR_1998 (xylA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2043137..2044477
Genome map
AA seq 446 aa AA seqDB search
MSNTVFIGAKEYFPGIGKIGFEGRDSDNPLAFKVYDANKQVAGKSMAEHLRFAVAYWHSF
CGNGADPFGPGTRAYPWDVGNTALARAEAKSDAAFEFFTKLGVPYYCFHDIDLAPDADDI
GEYENNLKHMVGIAKQRQADTGVKLLWGTANLFSHPRYMNGASTNPDFNVVARAAVQVKA
AIDATVELGGENYVFWGGREGYACLHNTQMKREQDNMARFLTLARDYGRAIGFKGNFLIE
PKPMEPMKHQYDFDSATVIGFLRQHGLDQDFKLNIEANHATLSGHSFEHDLQVASDAGLL
GSIDANRGNPQNGWDTDQFPTDLYDTVGAMLVVLRQGGLAPGGLNFDAKVRRESSDPQDL
FLAHIGGMDAFARGLEVADALLTSSPLETWRAQRYASFDSGAGADFANGTSTLAELAKYA
AGKGEPTQLSGRQEAYENLINQYLTR
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacaccgttttcatcggcgcgaaagaatatttccccggcatcggcaagatcggc
ttcgaaggccgtgattcggacaacccgctcgcgttcaaggtgtacgacgccaacaagcag
gtcgccggcaagagcatggccgagcacctgcgctttgcagtggcttactggcacagcttc
tgcggcaatggcgccgatccgttcggcccgggcacgcgcgcgtatccgtgggatgtaggc
aacaccgcgctggcgcgtgccgaagccaagtccgatgccgcgttcgaattcttcaccaag
ctcggcgtgccgtactactgcttccacgacatcgatctggcgccggatgcggacgacatc
ggcgagtacgaaaacaacctcaagcacatggtcggcattgccaagcagcgccaggccgac
accggcgtcaagctgctgtggggtaccgccaatctgttctcgcacccgcgctacatgaat
ggtgcctccaccaatccggacttcaatgtcgtggcgcgcgctgcggtgcaggtcaaggcc
gcgatcgatgccacggtggagctgggcggcgagaactacgtattctggggcggccgcgaa
ggctatgcctgcctgcacaacacgcagatgaagcgcgagcaggacaacatggcgcgcttc
ctcaccctggcacgcgactacgggcgtgcgatcggcttcaaaggcaacttcctgatcgag
cccaagcccatggagccgatgaagcaccagtacgatttcgacagcgccacggtgatcggc
ttcctgcgccagcacggcctggaccaggatttcaagctcaatatcgaagccaaccacgcc
acgctgtcgggtcacagcttcgagcacgacctgcaggtggccagcgatgccggcctgctt
ggcagcatcgatgccaaccgcggcaacccgcagaacggctgggataccgaccagttcccg
accgacctgtacgacaccgtcggcgcgatgctggtggtgctgcgtcagggcgggctggca
ccgggcggtctgaatttcgatgccaaggtgcggcgtgagtcatccgatccgcaggatctg
ttcctggcccacatcggcggcatggatgcgttcgcacgcgggctggaagtggccgacgcg
ctgttgacctcctcaccgttggaaacctggcgcgcgcagcgttacgccagcttcgacagc
ggcgcaggcgcagactttgccaacggcaccagcacgctggcggagctggccaagtacgcc
gccggcaagggcgagccgacgcagctcagcggccgccaggaagcctacgagaacctgatc
aatcagtatctgacgcgttga

DBGET integrated database retrieval system