KEGG   Xanthomonas campestris pv. raphani: XCR_2054Help
Entry
XCR_2054          CDS       T01872                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
xcp  Xanthomonas campestris pv. raphani
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:xcp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    XCR_2054 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    XCR_2054 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    XCR_2054 (thrC)
Enzymes [BR:xcp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     XCR_2054 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2115147..2116454
Genome map
AA seq 435 aa AA seqDB search
MMFISTRGAAPAVSLSQAIAAGLAPDGGLYVPQTLPPARTLQVGATLADTATTLLQPFFE
GDALAGELAAICAEAFDFPAPLVALATPGDYALELFHGPTAAFKDFGARFLAACLTRLRR
AEDRPLTILVATSGDTGAAVAAAFHRQPGLRVVVLYPDGRVSPRQAHQLGCFGDNIQAVR
VAGTFDDCQAMVKQALNDGELQAQVPLSSANSISLGRLLPQMSYYAHAALQHHAGSGAAL
NLVVPTGNLGNGLAAILARALGVPLGQIVLASNANHVLPDYFAGDDYAPQPSVATVANAM
DVGAPSNFERLRWLYDGDDAALREAFRALSVDDTAIRHTVQQRFARYGEVHCPHTATAVH
VLEQLRAEGAEGGTGDWAVAATAHPAKFEAVVEPLIGRAVEIPPALAALLLRPAHAEPLA
PDYQAFRQRLLADAP
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgatgttcatctctacccgtggcgccgcacctgccgtgagcctgagccaggcgatcgcc
gccggcctggccccggacggcggcctgtacgtgccgcaaaccctgccgccggcgcgcacc
ctgcaggtcggcgcaacgctggccgacacggccaccacactgctgcagccgttcttcgag
ggcgacgcgctggcaggcgagctggcggccatctgcgccgaagcgttcgatttcccggcg
ccgctggtggcgctggccacgccgggcgactacgcgctggagctgttccatggccccacc
gcagccttcaaggattttggtgcgcggtttctggcagcttgcctgacccggctgcggcgc
gccgaagaccgcccgctgaccattctggtggccacctccggcgataccggcgcggccgtg
gcggcggcgttccatcggcagcccggcctgcgggtggtggtgctgtatccggatggccgc
gtgtcgccacggcaggcgcatcagctgggctgcttcggcgacaacatccaggcagtgcgt
gtggccggcaccttcgacgactgccaggccatggtcaagcaggccttgaacgatggcgag
ctgcaggcgcaggtgccgctgagttcggccaatagcatcagcctggggcggctgctgccg
cagatgagctactacgcgcacgcagcgctgcagcaccacgctggctccggggccgcattg
aacctggtggtgcccaccggcaacctgggcaacggcttggccgcgatcctggcacgcgcg
ctcggcgtgccgctgggccagatcgtgctggcgtccaacgccaaccatgtattgcccgac
tacttcgccggcgacgactacgccccgcaacccagcgtggccaccgttgccaacgcgatg
gacgtgggcgcgcccagcaatttcgaacgcctgcgttggctgtatgacggcgacgatgcg
gcgctgcgcgaggcgttccgtgcgctctcggtggatgacacggcgatccgccacaccgtg
cagcaacgcttcgcacgctacggcgaagtgcattgcccgcataccgccaccgccgtgcac
gtactggagcaattgcgtgcggaaggggccgagggcggcactggcgactgggcggtggcg
gccacggcgcacccggcaaagttcgaggcggtggtggagccactgatcggccgcgcggtg
gagatcccgccggcgctggcggccttgttgctgcgcccggcgcatgccgaaccgctggca
ccggactatcaagcgttccggcagcgtctgctcgcggatgcgccctga

DBGET integrated database retrieval system