KEGG   Xylella fastidiosa subsp. fastidiosa GB514: XFLM_03615Help
Entry
XFLM_03615        CDS       T01979                                 

Definition
Beta-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
xff  Xylella fastidiosa subsp. fastidiosa GB514
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:xff00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    XFLM_03615
Enzymes [BR:xff01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     XFLM_03615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
744827..746665
Genome map
AA seq 612 aa AA seqDB search
MLRHLLTLSLIFAIVLPIGVSAAPWPAFSTRGTQFIRDGRPYQLISGAIHFQRIPRAYWK
DRLQKARAMGLNTVETYVFWNLVELREGQFDFTGNNDIGAFVREAASQGLNVILRPGPYV
CAEWEAGGFPAWLFADPTLRVRSQDPRFLDASQRYLEALGTQVRPLLNGNGGPIIAVQVE
NEYGSYGDDHGYLQAVRALFIKAGLGGALLFTADGAQMLGNGTLPDVLAAVNVAPGEAKQ
ALDKLATFHPGQPQLVGEYWAGWFDQWGKPHAQTDAKQQADEIEWMLRQGHSINLYMFVG
GTSFGFMNGANFQGGPSDHYSPQTTSYDYDAVLDEAGRPMPKFALFRDVITRVTGLQPPP
LPAASRFIDLPDTPLRASASLWDNLPAAVATTADPQPMERYGQAYGYILYRTTLHGPRKG
RLYLGEVRDDAHVYVDRLFVGRAERRRQQVWVEVDIPSGTHCLDVLVENSGRVNYGPHLA
DGRAGLIGPVMLNHERVNNWETFLLPLQTPEAIHGWTTAPMQGPAFHRGTLFIRTPGDTF
LDMEAFSKGVTWANGHMLGRYWDIGPQRALYFPGAWQRQGENTVLVFDVSDTAAAQVRGV
QQQRWITPRTAK
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgtcacctgctcacgttgtcgctgatattcgcaatcgtgctgcccattggagtt
agcgccgcgccttggcctgctttttcaactcggggaacgcaattcatccgtgatgggagg
ccgtatcagttgatctcgggtgccatccacttccaacgcatcccgcgggcgtactggaag
gaccgtttgcaaaaagcccgagcaatggggttgaacacggtggaaacctatgttttctgg
aacctggttgaactccgtgaaggtcaattcgacttcacagggaataacgacattggtgct
tttgtgcgtgaagcagcgtcgcaaggtctgaacgtgattctgcgtcccgggccatatgtg
tgtgcagaatgggaggcaggggggttcccagcgtggctgttcgccgatccaacgctacgg
gtgcgcagtcaggatccgcgttttcttgatgccagtcagcgctatctggaggcactcggc
acacaggtcaggccgctgctcaatggcaatggcggtcccatcattgcagtgcaggttgag
aatgagtacggctcttatggggatgatcatggctatctacaggctgtgcgcgcgctattc
atcaaggccggtttgggaggtgcgctgttgtttaccgccgacggggctcagatgcttggc
aatggcacgctgccggacgtgctggcggcggtgaatgtcgcaccgggtgaggcaaaacag
gcgctcgacaagctcgccacattccatcctgggcagccgcagctggtgggtgaatattgg
gcggggtggttcgaccagtggggcaagccgcatgcgcagactgatgcaaagcagcaggct
gatgagatcgaatggatgttgcggcaagggcattcgatcaatctgtatatgtttgttggc
ggcaccagttttggttttatgaatggtgctaacttccaaggtggtcccagtgaccattac
agccctcaaaccacaagctacgattacgatgcggtgttggacgaagccggacggccgatg
ccgaagttcgcgctgttccgcgatgtcatcacccgtgtgactggtctccagccgccgcct
ttgccagcggcaagccgttttatcgatttgccggacacgccattgcgcgcatccgcttcg
ctctgggacaacctgcctgcagcggtcgccaccacagcagatccgcagccgatggagcgc
tatgggcaggcctacggttacattttgtaccgcaccacgctccacgggccacggaagggc
aggctgtatctgggtgaggtgcgggatgacgcccatgtctacgttgatcgtctcttcgtg
ggtcgggcggaacggcgtcggcagcaggtctgggtggaggttgacattccctccggtact
cactgtctggatgtcttggtagaaaacagtggacgggttaactacggtccgcacctggct
gacggccgcgccgggctgattggtccggtgatgctcaatcatgaacgcgtcaacaattgg
gaaacgttcctgctgccgttgcagacgcccgaagcgatccacggttggacaaccgcaccg
atgcaaggacctgcttttcatcgtggcacgttgtttatccgcacgcctggagacacattt
ttggatatggaggctttcagcaagggggtgacctgggccaatggtcacatgcttggccgc
tactgggacatcggcccgcagcgggcgctttacttcccgggggcgtggcagcgccaaggg
gagaatacggtgctcgtcttcgatgtgagcgatacggcagcagcacaggtacgcggtgtg
cagcagcaacgctggatcactccaaggacggccaaataa

DBGET integrated database retrieval system