KEGG   Xylella fastidiosa M23: XfasM23_1133Help
Entry
XfasM23_1133      CDS       T00692                                 

Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
xfn  Xylella fastidiosa M23
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:xfn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    XfasM23_1133
Enzymes [BR:xfn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     XfasM23_1133
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1279607..1280389
Genome map
AA seq 260 aa AA seqDB search
MHTMTRPDQARTPWYLLSLRPANNHAALRRAVARYGGGLIALSPWRLKRLDSPETRSALA
SALTASTLVFTSPEAVRAAHALQTLRTSPGQVWLCVGASTARVLQQCGITRVLHPTQMNS
EGLLTLLAQQPPTEVGLITAPGGRDLLQQKLLENGIRLHRADVYERQPLRLRTATLDTLQ
RNATRSLLALSSAEALALLLPQWPDNLRRILYQRPVIATSKRLEDLACARGFISVYRATG
PLPRQLAATAAAFRPDKTAQ
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgcacaccatgacaagaccagaccaagcccgcaccccatggtatttgttgtcactacgt
ccggcaaacaaccacgccgcactgcgccgtgccgtcgcgcgttacggaggaggattaatc
gcactatccccgtggcgattaaagcgtctagacagtccagagacacgctctgcattagca
tcagcattgacggcatcaaccctggttttcaccagtccagaggcagtacgtgcggcacat
gctctgcaaacgctacgcacttcacctggacaagtatggttgtgcgttggcgcaagcact
gcacgcgtgctacaacagtgcggtattacacgcgtgttgcacccaacacaaatgaacagt
gaagggttactcacattactggcacagcaacccccaaccgaagttggacttattaccgca
ccaggaggacgtgatttactccagcagaagcttttagaaaatggcatacggttacatcgt
gccgatgtctacgaacgtcaaccgttacgtctgcgcacagccacattggatacactccag
cgtaatgccacacgtagcctgcttgcactgagcagtgccgaagctttagcactcttactg
ccacaatggccggataacctgcgaaggatcctgtaccagcgtccagtgattgcaacaagc
aaacggctagaagatctagcatgcgcgcgaggatttatcagcgtttatcgcgccacagga
ccattgccgcgccagttagcagcaacagcagcggcttttcgacccgataaaacagcacaa
tga

DBGET integrated database retrieval system