KEGG   Xenopus laevis (African clawed frog): 100037155Help
Entry
100037155         CDS       T01010                                 

Gene name
anapc13.2, anapc13, apc13, swm1
Definition
anaphase promoting complex subunit 13, gene 2
Orthology
K12456  
anaphase-promoting complex subunit 13
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Cell cycle
Oocyte meiosis
Ubiquitin mediated proteolysis
Progesterone-mediated oocyte maturation
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:xla04120]
Cellular Processes; Cell growth and death; Cell cycle [PATH:xla04110]
Cellular Processes; Cell growth and death; Oocyte meiosis [PATH:xla04114]
Organismal Systems; Endocrine system; Progesterone-mediated oocyte maturation [PATH:xla04914]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 74 aa AA seqDB search
MDSEVLRDGRILDLIDDAWREDKLPYEDVTIPLNELPEPEQDNGGATESVKEQEMKWADL
ALQYLHENIPSSGS
NT seq 225 nt NT seq  +upstreamnt  +downstreamnt
atggacagcgaggtgctgagagatggacggattttagatctaatcgatgacgcttggagg
gaggataaactgccatatgaggatgtgaccatccctctgaatgagcttccggagccagag
caggataatggaggagcaacagagtctgttaaagaacaggaaatgaaatgggctgatctg
gcactgcagtatttacatgaaaacattccttcatcgggcagctaa

DBGET integrated database retrieval system