KEGG   Xenopus laevis (African clawed frog): 100037155Help
Entry
100037155         CDS       T01010                                 

Gene name
anapc13.2, anapc13, apc13, swm1
Definition
anaphase promoting complex subunit 13, gene 2
Orthology
K12456  
anaphase-promoting complex subunit 13
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Cell cycle
Oocyte meiosis
Ubiquitin mediated proteolysis
Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:xla00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100037155 (anapc13.2)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    100037155 (anapc13.2)
   04114 Oocyte meiosis
    100037155 (anapc13.2)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100037155 (anapc13.2)
Ubiquitin system [BR:xla04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     100037155 (anapc13.2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 74 aa AA seqDB search
MDSEVLRDGRILDLIDDAWREDKLPYEDVTIPLNELPEPEQDNGGATESVKEQEMKWADL
ALQYLHENIPSSGS
NT seq 225 nt NT seq  +upstreamnt  +downstreamnt
atggacagcgaggtgctgagagatggacggattttagatctaatcgatgacgcttggagg
gaggataaactgccatatgaggatgtgaccatccctctgaatgagcttccggagccagag
caggataatggaggagcaacagagtctgttaaagaacaggaaatgaaatgggctgatctg
gcactgcagtatttacatgaaaacattccttcatcgggcagctaa

DBGET integrated database retrieval system