KEGG   Xenopus laevis (African clawed frog): 380168Help
Entry
380168            CDS       T01010                                 

Gene name
tpi1, TIM, tpi
Definition
triosephosphate isomerase 1 (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:xla00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    380168 (tpi1)
   01230 Biosynthesis of amino acids
    380168 (tpi1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    380168 (tpi1)
   00051 Fructose and mannose metabolism
    380168 (tpi1)
   00562 Inositol phosphate metabolism
    380168 (tpi1)
Enzymes [BR:xla01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     380168 (tpi1)
Exosome [BR:xla04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   380168 (tpi1)
  Exosomal proteins of bladder cancer cells
   380168 (tpi1)
  Exosomal proteins of melanoma cells
   380168 (tpi1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 248 aa AA seqDB search
MSPRKFFVGGNWKMNGDKKSLGELINTLNSGKMNADTEVVCGAPAIYLDFARQKLDAKIA
LSAQNCYKVAKGAFTGEISPAMIKDCGATWVILGHSERRHVFGECDELIGQKVAHALSEG
IGVIACIGEKLDQREAGITEKVVFEQTKAIADNVKDWSKVVLAYEPVWAIGTGKTATPEQ
AQEVHKKLREWVKTNVSEGVAQSVRIIYGGSVTGGTCRELAGQPDIDGFLVGGASLKPEF
IEIINAKH
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgtctcccaggaagttcttcgtcgggggcaattggaagatgaacggagacaagaagagt
ctgggggagctgatcaacaccctgaacagcggcaagatgaacgcggacacagaggtggtc
tgtggtgcaccagccatttatctggactttgcacggcagaagctggacgccaaaattgct
ctttctgcgcagaattgttataaagtggccaagggagcattcaccggagagatcagccca
gcaatgattaaagactgtggtgctacatgggtgattcttgggcactctgagagacggcat
gtgtttggagagtgtgacgagctcattgggcaaaaagtggcacacgcactaagtgaaggc
attggagtgatcgcctgtattggtgagaagctagaccagcgtgaggcgggaatcactgag
aaggtggtgtttgagcagacaaaggccatagcagataatgtcaaggactggagtaaggtg
gtcttggcctatgaaccagtctgggctattggaactgggaaaactgccacacctgaacag
gcccaggaagtgcacaagaaactgcgtgagtgggtgaaaaccaacgtatctgaaggtgtt
gcccagtctgttcgtattatatatggaggttcagtaacaggaggcacatgcagagagctg
gccggccagcctgacattgatgggttcctggtgggaggagcatctctgaagccggagttc
attgaaataatcaatgccaagcattaa

DBGET integrated database retrieval system