KEGG   Xenopus laevis (African clawed frog): 380168Help
Entry
380168            CDS       T01010                                 

Gene name
tpi1, TIM, tpi
Definition
triosephosphate isomerase 1 (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:xla01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:xla01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:xla00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:xla00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:xla00562]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 248 aa AA seqDB search
MSPRKFFVGGNWKMNGDKKSLGELINTLNSGKMNADTEVVCGAPAIYLDFARQKLDAKIA
LSAQNCYKVAKGAFTGEISPAMIKDCGATWVILGHSERRHVFGECDELIGQKVAHALSEG
IGVIACIGEKLDQREAGITEKVVFEQTKAIADNVKDWSKVVLAYEPVWAIGTGKTATPEQ
AQEVHKKLREWVKTNVSEGVAQSVRIIYGGSVTGGTCRELAGQPDIDGFLVGGASLKPEF
IEIINAKH
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgtctcccaggaagttcttcgtcgggggcaattggaagatgaacggagacaagaagagt
ctgggggagctgatcaacaccctgaacagcggcaagatgaacgcggacacagaggtggtc
tgtggtgcaccagccatttatctggactttgcacggcagaagctggacgccaaaattgct
ctttctgcgcagaattgttataaagtggccaagggagcattcaccggagagatcagccca
gcaatgattaaagactgtggtgctacatgggtgattcttgggcactctgagagacggcat
gtgtttggagagtgtgacgagctcattgggcaaaaagtggcacacgcactaagtgaaggc
attggagtgatcgcctgtattggtgagaagctagaccagcgtgaggcgggaatcactgag
aaggtggtgtttgagcagacaaaggccatagcagataatgtcaaggactggagtaaggtg
gtcttggcctatgaaccagtctgggctattggaactgggaaaactgccacacctgaacag
gcccaggaagtgcacaagaaactgcgtgagtgggtgaaaaccaacgtatctgaaggtgtt
gcccagtctgttcgtattatatatggaggttcagtaacaggaggcacatgcagagagctg
gccggccagcctgacattgatgggttcctggtgggaggagcatctctgaagccggagttc
attgaaataatcaatgccaagcattaa

DBGET integrated database retrieval system