KEGG   Xenopus laevis (African clawed frog): 432195Help
Entry
432195            CDS       T01010                                 

Gene name
rad54b, fsbp, rdh54
Definition
RAD54 homolog B
Orthology
K10877  
DNA repair and recombination protein RAD54B [EC:3.6.4.-]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:xla00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    432195 (rad54b)
Enzymes [BR:xla01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     432195 (rad54b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 895 aa AA seqDB search
MRRSAAPSQLCGNPAKKPRFIPPGNVNKTCPDTEMKHSITDLKDKTELSSRAFGRICGLN
TVLHRTEASVVPVCSGKTAIMTSVPVCRSVAVKEHKNEEEESSSFAKYFSVVWCKASKKK
HKKWEGDAILIAKGRAVTLKDMEGKDIGKGTGYKIKDLESLEEGQTLMIGGKEIEVMGII
SPEDYNSGRCFHSVVTSSTSIPSESIQVKPFTNPLKNDSKTTNKDNMFKELQNIKPRHDP
SAPNAFVMPKPSQQHQWAFNKSGLPIVDVVVDPYLAVHLRPHQKEGILFLYECVMGMRVN
ERFGAILADEMGLGKTLQCISLIWTLLRQGPYGAKPVIKRALIVTPGSLVKNWRKEFQKW
LGTERIRVFAVDQDHKVEEFVNSPLYSVLIISYEMLLRCLEQIESLDFDLVICDEGHRLK
NTSIKTTTSLTSLTCSKRIILSGTPVQNDLQEFFALIEFVNPAVLGSLSTYRKVFEEPIV
RSREPTATPEEKNLGEERAAELARLTGLFILRRTQEVINKFLPPKIENIVFCQPSQFQLD
LYRRLLNSRAVKSCLLGNGENSPHLVCIGALKKLCNHPCLLFRTIQEKSTNPDQGEHSLY
ESIAELFPQDYDGAKISESESGKLLVLSKLLSGIRELSPSERVVLVSHYTQTLNILQALC
VQHGYSCTRLDGQTPVTQRQHIVDGFNSKYSSDFIFLLSSKAGGVGLNLIGASHLILYDI
DWNPANDIQAMARVWRDGQRRTVHIYRLLTTGSLEEKIYQRQISKQGLSGAVVDLTKKSE
HIRFSVDELRNLFTLHEDTDCVTHELLECDCIKTNCLSDGLPQKPLIHRSCQLELHRDQL
NKNFSMSELMQWKHFSGQQSTDDPFLQMGKEHISFVFQNTTNIQVNPTSELSPAV
NT seq 2688 nt NT seq  +upstreamnt  +downstreamnt
atgcgaagatcggcagccccaagtcaactctgtgggaatccagcaaagaaacctcgcttt
atacctcctggaaatgttaataaaacgtgcccagatacagaaatgaaacattcaataact
gatttgaaggataaaacagaattgtcttcaagagcctttggaagaatatgtggtctgaac
acagtgcttcacaggacagaagcaagtgtggtgccagtgtgcagtggtaaaacagccatt
atgacaagtgttccagtgtgtagatctgtggctgtaaaagaacacaagaatgaggaggaa
gaatccagctcttttgcaaagtatttcagcgtggtttggtgcaaggcctctaagaagaaa
cacaagaagtgggaaggagatgcaatcttaatcgctaaagggagagcagtgacattaaag
gacatggagggaaaagatattggaaaaggtacagggtacaagataaaagacctggaaagc
ctggaagagggccagactctgatgattggtggaaaagagatagaagtcatgggcataatc
tctcctgaagattacaacagtggccgatgtttccactctgtagtgacatcatctacctct
atcccttcagaatccattcaagtgaaacccttcaccaacccattgaaaaatgacagcaag
actactaacaaggacaatatgtttaaagagctacagaatatcaagcctcgccatgatcct
agtgccccaaatgcctttgttatgccaaaaccaagtcagcagcaccagtgggcttttaat
aagtctggcttgccaatcgtagatgtggtggtggatccctatttagctgttcatcttaga
cctcatcagaaggaagggattctctttctttacgaatgtgtaatgggaatgagggttaat
gagcggtttggcgctatccttgccgacgaaatgggtctagggaaaaccctccagtgcatc
tccttgatttggacactcctccgtcagggcccatatggggccaaacctgttataaagaga
gctctcattgtcacgcctggcagtctggtgaagaactggaggaaggaattccagaagtgg
ctgggaacagagcgtatcagagtatttgcagttgaccaggatcacaaagtggaagagttc
gtcaactcccctctttattccgtgctcataataagctatgagatgctgttacgctgtctg
gaacaaatagagagcctagattttgatctagttatttgtgacgagggtcatcgcctaaag
aatacgtctataaaaactacgacctccctgaccagtctaacttgcagcaaacgaatcata
ttgtccgggactccagttcagaatgatctgcaggagttttttgcactgattgagtttgta
aacccagcagttctgggctctttgtccacgtacagaaaagtctttgaggagccaattgtt
aggtctcgggagccaacagcaacacctgaagagaagaatttgggagaagaacgagcagct
gaacttgcaaggctgaccggtctttttatacttagaaggacccaggaggtcataaataaa
ttcctgcctccgaaaatcgaaaacattgtcttctgccaaccatctcaattccagcttgat
ctgtacagaaggcttctgaattcaagggctgttaaatcctgtctgctgggaaatggagaa
aacagcccccacctggtgtgcattggtgcacttaaaaaactatgcaaccatccatgcttg
ctgttcagaactatccaggagaaaagcacaaatcctgatcagggtgaacacagtctgtat
gaaagtatagctgaacttttcccccaggattatgatggtgctaaaatttcagagtccgag
tctggaaaactgctggtcctgagtaagctgctgtctggaatacgggaactcagcccatct
gagagggtggtattggtctcccattatacacagaccctaaacattttgcaagccctgtgc
gttcagcatggatacagttgcacaaggctggatgggcagaccccggttacacagagacag
cacattgtcgatggatttaacagcaaatactcctcagacttcatcttcttgctgagctcc
aaggctgggggcgttggcctcaatctgattggtgcttctcatttaattctgtatgacatt
gactggaatcctgctaatgatatacaggcaatggctcgagtgtggagggatggacagagg
cgcactgtgcatatttacaggcttctcactacaggctcattagaggaaaagatctaccag
aggcagataagtaagcaaggcctgtctggtgctgttgtggacttgacaaagaaatccgag
cacatccgcttctctgtagatgagctgagaaatctatttactttgcatgaagatacagat
tgtgtgactcacgagctgctggaatgtgactgcataaaaacaaactgtctttcagatggt
ttgcctcaaaagccattaatccataggagttgtcagcttgaattacaccgggatcagctt
aataagaatttttccatgtctgagctcatgcagtggaaacatttctccgggcagcagagt
acggatgatccctttctgcaaatgggaaaagaacatatttctttcgtttttcagaacaca
acaaacatccaagtaaacccaacgtcagaactttctcctgccgtgtga

DBGET integrated database retrieval system