KEGG   Xenopus laevis (African clawed frog): 443879Help
Entry
443879            CDS       T01010                                 

Gene name
acss2.2, acas2, acecs, acs, acsa, acss2
Definition
acyl-CoA synthetase short-chain family member 2, gene 2 (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:xla00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    443879 (acss2.2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    443879 (acss2.2)
   00620 Pyruvate metabolism
    443879 (acss2.2)
   00640 Propanoate metabolism
    443879 (acss2.2)
Enzymes [BR:xla01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     443879 (acss2.2)
Lipid biosynthesis proteins [BR:xla01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   443879 (acss2.2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 680 aa AA seqDB search
MPSQVRGKEEDGTGAEDATYPPPALLQRQAHVKDFSTYTDMYNRSVHNPQEFWLEAASEF
SWKTSPSGKVLDYNFDITKGKIFVEFMKGAKTNVCYNVLDRNVMEKNLGDKTAFLWEGNS
PDNSSVISYWDLLKQVCKFANVLIKLGVKKGDRVAIYLPMIPELVYAMLACARIGAVHSI
VFAGFSSESLCERILDSQCVVLITADGVFRGEKPINLKQIADEALQKCNEKMHHVKNCVV
VKHLKGRLNNQNEGKFQTAWNSDVDRWLDELMADASEECEPEWLDAEDPLFILYTSGSTG
KPKGVVHTVAGYLLYTALTFKYVFDYHENDIYWSTADIGWITGHSYIVYGPLANGATSVM
FEGIPTYPHVGRFWEIVQKYKVTQFYTAPTAIRLLMKYGNEAVQKFDLSSLKILGTVGEP
INSEAWLWYYNVIGNQRCPIVDTFWQTETGGHVVTPLPAATPLKPGSATFPFFGVVPAVL
NEHGKELEGEAEGYLVFKQPWPSIMRTLYGNHERYENTYFKKFPGYYVAGDGCRRDKDGY
IWITGRIDDMLNVSGHLLSTAEVEAALTEHPAVAEAAVVSRPHQVKGECLYCFIILKDGI
KYTERIAEEVKKQVREKIGPIATPDFIQNAPGLPKTRSGKIMRRVLRQIARNEKDLGDIS
TLADPSIVEVLFSQRCEAAA
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atgccaagccaagtgagaggcaaagaagaagatggcaccggggcagaagatgccacctac
ccgcctccagctcttcttcagcgtcaggcgcacgtgaaagacttcagcacatacacagac
atgtacaaccgatcagtgcacaacccacaagagttctggttggaagcggcctctgaattc
tcctggaaaacatcaccttctggaaaagttctggattataattttgacataaccaaaggc
aagatttttgtggagtttatgaaaggggccaaaaccaatgtctgttacaatgtcctggac
aggaatgtcatggagaaaaacctgggagacaagactgcatttttatgggagggcaattcg
ccagacaactcttctgtcatctcatactgggatctactgaaacaagtctgcaagtttgca
aatgttttaatcaaattaggggtaaagaaaggggacagagtggccatttacttgccaatg
attcctgaattggtatatgccatgttggcatgtgcccgaattggagccgttcactcgata
gtatttgcaggcttttcctcggaatccctgtgtgaaagaattttggactctcagtgtgtt
gttcttattactgcagatggagtcttccgaggagaaaaaccaattaacttgaaacaaatc
gcagatgaggcacttcaaaaatgcaatgaaaaaatgcaccatgtcaaaaactgtgttgtg
gtgaagcacctcaagggaaggctgaacaatcaaaatgaaggaaaatttcagacagcctgg
aattcagatgttgaccgatggttggacgaactgatggcagatgccagtgaggagtgtgaa
ccagaatggctggatgctgaagacccacttttcatcctttatacaagtggctctactgga
aagccaaagggagtggtgcatacagttgcaggctaccttctgtacacggctttaacattc
aaatatgtgtttgactatcatgagaatgatatttactggagcacagctgacattggatgg
attacaggccactcatatatagtatatggaccactggccaacggagctactagtgtgatg
tttgaaggcattcctacctatcctcatgtggggagattttgggaaatcgtccagaagtac
aaagtaacccagttttacactgcgccaactgctatccgattgctgatgaaatatggaaat
gaagctgttcaaaagttcgacttaagctctttgaagattctgggcacggtaggagaaccc
ataaattccgaagcatggctgtggtattacaacgttattggcaatcagcgatgtcccatt
gtggacaccttttggcaaaccgagacaggtggtcatgtggtaactcccttgcctgctgct
acccctctgaaacctggatcagctacctttccttttttcggagttgtccctgctgttctg
aatgaacatggaaaggagttagaaggggaagctgagggctacttggtattcaagcagcca
tggccatcaataatgagaactctttatggaaaccacgaacgctatgaaaatacctacttc
aaaaaattccctgggtattacgtagcaggcgatggttgcagaagggacaaagacggctac
atttggattacaggacggattgatgacatgcttaatgtttcaggacacctgttaagcaca
gcagaggtggaggcagccctgacagagcacccagcagtggcagaggctgcagttgtgagc
cgcccgcaccaggtaaagggagaatgcctctactgcttcatcattttaaaagatggcatt
aaatatacagaacggattgccgaagaggtgaagaagcaagtacgtgaaaagattggaccc
atcgcaacaccagatttcatccagaatgctcctggattgccgaaaaccagatcaggaaaa
ataatgcgacgagttctcaggcaaatcgctcgaaatgagaaggatttgggagacatttcg
actctggcagacccaagtattgttgaagtcttgttcagtcaaagatgtgaggctgcagca
tga

DBGET integrated database retrieval system