KEGG   Xenorhabdus nematophila ATCC 19061: XNC1_0694Help
Entry
XNC1_0694         CDS       T01274                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
xne  Xenorhabdus nematophila ATCC 19061
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:xne00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    XNC1_0694 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    XNC1_0694 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    XNC1_0694 (thrC)
Enzymes [BR:xne01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     XNC1_0694 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
604008..605297
Genome map
AA seq 429 aa AA seqDB search
MKLYNLKDSSEQVSFSQAVKQGLGKQQGLFFPQDLPEFSRDEIDELLKLDFVSRSQKILS
AFIGDEIPAEQLMTRVKNAFAFPVPVTKVEDDIASLELYHGPTLAFKDFGGRFMAQILAQ
IAGEQPVTILTATSGDTGAAVAHAFYGLDNVQVVILYPEGKISPLQEKLFCTLGGNIHTV
AINGDFDACQALVKQAFDDDELKCALHLNSANSINISRLLAQICYYFEAVAQIPAEKREQ
LVISVPSGNFGNLTAGLLAKSLGLPVKRFIAATNVNDTVPRYLAQGEWQPSQTIATLSNA
MDVSQPNNWPRIEELFKRKGWALSELANGVVDDETTQSTVCELAGKGYISEPHAAIAYRI
LRDQLQDGEYGLFLGTAHPAKFRESVEATLGQSLPLPEELAERADLALLSHFLPAEFSTL
REFLMEEIT
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaaactctataacttaaaagacagcagcgagcaggtcagtttttctcaggcggtaaaa
cagggattaggcaaacaacaagggctcttttttccacaagatttgcctgaattcagccgt
gatgaaattgatgaattactgaaactggattttgtcagccgtagccagaaaattctctcc
gcttttattggcgatgaaattcctgccgagcaattgatgacccgcgttaaaaacgccttt
gccttccctgtgcccgtgaccaaggttgaagatgatattgcttcactggagctttatcac
ggtccgacactggctttcaaagatttcggcggtcgtttcatggcgcaaattcttgcccaa
atcgcgggagagcaacccgtcactattttgaccgcaacatccggagacactggcgctgcg
gttgctcatgctttttatgggctggataacgtacaagttgtgatcttgtatcccgaaggc
aaaatcagcccgttgcaggaaaaactcttctgtacactgggtggcaatattcatactgtt
gccatcaatggcgatttcgacgcttgccaggcattggtcaaacaggcatttgatgatgac
gagctgaaatgtgccctgcatcttaattcagctaattcaattaatatcagccgcttattg
gcacaaatctgttattactttgaagccgttgcccagatcccggcagaaaaacgtgaacag
ttggtcatttccgtgccaagtggcaattttggtaacttaacggcgggattactggcgaaa
tcactcggattgccggtaaaacgttttatcgcggcaaccaatgtcaatgatacggttccc
cgttatttagctcagggtgaatggcagccaagccaaactatcgcaacattgtccaatgca
atggatgtcagtcaacccaataactggccacgtattgaagaactatttaaacgcaaaggc
tgggcattaagtgaattggcaaacggggttgtggatgatgaaaccactcaaagcactgtg
tgtgagctggcggggaaagggtatatttctgagccacatgctgccattgcttatcgtatc
ctgcgggatcaattacaggacggggaatatggcttattcctgggtacagctcatccggct
aaattcagggaaagcgttgaagctaccctcggtcagtcactgccgttacccgaagaatta
gcagaaagagcggatctggccttattgtctcacttcctgcctgctgagttctcaaccctg
cgtgaattcctgatggaagaaataacatag

DBGET integrated database retrieval system