KEGG   Xanthomonas oryzae pv. oryzicola: XOC_4230Help
Entry
XOC_4230          CDS       T01873                                 

Definition
phosphomannomutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
xor  Xanthomonas oryzae pv. oryzicola
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:xor00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XOC_4230
   00030 Pentose phosphate pathway
    XOC_4230
   00051 Fructose and mannose metabolism
    XOC_4230
   00052 Galactose metabolism
    XOC_4230
   00500 Starch and sucrose metabolism
    XOC_4230
   00520 Amino sugar and nucleotide sugar metabolism
    XOC_4230
  Nucleotide metabolism
   00230 Purine metabolism
    XOC_4230
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    XOC_4230
Enzymes [BR:xor01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     XOC_4230
    5.4.2.8  phosphomannomutase
     XOC_4230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4377652..4380000)
Genome map
AA seq 782 aa AA seqDB search
MSKANERRQAMSSVRTIGLVLAGILLLLAAWFGWNSYAQWRKDAVAQNLEQARDRAVQDV
GQAMATQASQLDAVLKQPPVVAALAGGDALAAASAIRERFKGAEDVQVLPGDLAAAYANP
KDFGYARLSLLESAQVADHAQVHVIRDAKQVRLGIAAAVRLGAQPAVAYVRLPLLRLTAP
LDAIAVPGSAYLALRQGSYNVAQQGDAGLSDAAETLAKPLGTSGLRVAAAVPQGNSGPFG
PGAVGCAIVAALLLIIAVLLVLASRGQVALPRRRVAGQSSADEPTLSQSLQQDAGIASEA
RALDVDASPTVPPVLVPAVQIATEMFRAYDIRGVVGKDLNPGVAALIGQAIGSVMQAQGL
RHVVVGRDGRLSGPELTNGLIEGLRRAGCNVTDIGLAPTPVVYFGAYELRAGSCVAVTGS
HNPPDYNGFKIVIGGETLSGTAIAELHQSINEGRLHTAATPGELEQRDISHAYIQRIADD
VQLDRPIKVVVDAGNGVAGEIAPRLLEAIGAKVVPLYCDIDGTFPNHHPDPSEPHNLDDL
VRMVQRFDADIGVAFDGDADRLGVVTKEGTVVFPDRLLMLFAADVLQRNPGALVIYDVKC
TGKLSDYVLRNGGSPLMWKTGHSLIKSKMRETDAELAGEMSGHFFFKERWYGFDDGIYAA
ARLLEILAQREQTPSEVLDALPESVSTPEIKVPVEGDAHALVARFVERAQTGGESPFESA
RLSTIDGLRADFVDGWGLVRASNTTPILVLRFEADSEAALQRIRTLFREELQALVPAHPL
AF
NT seq 2349 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaggcgaacgagcgcaggcaggcgatgtccagcgtgcgtacgattggtctggtg
ttggcgggcatattgctgttgctggccgcttggttcggctggaacagttatgcgcaatgg
cgcaaagacgcggtggcgcagaacctggagcaggcgcgcgatcgcgcagtgcaggacgtg
ggccaggcgatggccacgcaggccagccagctcgacgccgtgctcaagcagccgccggtg
gtcgctgccctggccggtggcgacgcgctggcggccgcatcggccatccgcgagcgcttc
aagggcgccgaggatgtgcaggtgttgcctggcgacctcgccgcggcctatgccaacccc
aaggatttcggttatgcgcgtctgagcctgctcgaatcggcgcaggtggccgatcatgca
caggtccacgtgatacgcgacgccaaacaggtgcgcttgggtattgcggcggcagtgcgc
ctgggtgcgcagccggcggtggcgtacgtgcggttgccgttgctgcgcctgaccgccccg
ctggatgcgatcgcagtgcccggcagcgcttatctggccttgcgccagggcagctacaac
gtggctcaacagggcgatgccggcttgtccgatgcggccgaaacgctggccaaaccgctc
ggcaccagcggcctacgcgtggctgcagcggtgccgcaaggcaatagcggcccatttggt
ccgggcgccgtcggttgcgccattgtggcggcgttgctgctgatcattgcagtgctgctg
gtgctggccagtcgggggcaggtggccttgccacgccgccgggttgccggccaatccagc
gccgatgaacccaccctcagtcagagcctgcagcaggacgccggcattgccagcgaagcg
cgcgcgctggacgtcgacgcctcgcccacagtgccgccggtgctggtgccggcggtgcag
atcgccaccgagatgttccgcgcctacgacatccgtggtgtggtcggcaaagacctcaac
cccggcgttgccgccttgatcggccaggccatcggcagcgtgatgcaggcgcagggcctg
cgccatgtggtggtcggccgcgacggccggctgtccggaccggagttgaccaatggcctg
atcgaaggcctgcgccgcgccggctgcaatgtcaccgacatcggcttggcgccgacgccg
gtggtgtacttcggtgcgtacgaactgcgtgccggcagctgcgtggcggtgaccggcagc
cacaatccgccggactacaacggcttcaagatcgtgatcggcggcgagaccttgtccggc
accgccattgccgaattgcaccagagcatcaacgaaggccgcctgcataccgctgccacg
cccggcgaactggagcagcgcgacatcagccatgcctacatccagcgcattgccgacgac
gtgcagctcgatcgcccgatcaaggtggtggtggacgccggcaacggcgtcgccggtgag
atcgcgccgcgccttctggaagcgatcggcgccaaagtggttccgttgtattgcgatatc
gacggcacttttcccaatcatcaccccgacccgagcgagccgcacaacctcgacgatctg
gtgaggatggtgcagcgtttcgatgcggatatcggcgtggcgttcgatggcgacgccgat
cgcctgggcgtggtcaccaaggaaggcacggtggtgttccccgaccgcctgctgatgctg
ttcgccgccgatgtgctgcagcgcaatcccggcgcgttggtcatctacgacgtgaaatgc
acaggcaagctgtccgactacgtgttgcgcaatggcggcagcccgttgatgtggaagacc
gggcattcgctgatcaaatccaagatgcgcgagaccgacgccgaactggctggcgagatg
agcgggcacttcttcttcaaggagcgctggtacggcttcgacgacggcatctacgccgct
gcacgcttgctggaaattctcgcccagcgcgagcagaccccgtccgaggtattggacgct
ttgcccgaaagcgtctccacgccggagatcaaggtgccggtggagggcgatgcgcatgcg
ctggtcgcgcgtttcgtcgagcgtgcgcagaccggcggagaatcgccgttcgagtcggca
cggctgtcgaccatcgatggcttgagggcggatttcgtcgatggctggggcctggtacgc
gcttccaacaccacgccgattctggtgctgcggttcgaagccgacagcgaggctgcattg
cagcggattcgcacgctgttccgcgaggaactgcaggcgttggtgcctgcgcatcccttg
gcgttctga

DBGET integrated database retrieval system