KEGG   Xenopus tropicalis (western clawed frog): 100170437Help
Entry
100170437         CDS       T01011                                 

Gene name
myl10, mylc2pl
Definition
myosin, light chain 10, regulatory
Orthology
K12756  
myosin regulatory light chain 10
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Focal adhesion
Tight junction
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100170437 (myl10)
  Cellular commiunity
   04510 Focal adhesion
    100170437 (myl10)
   04530 Tight junction
    100170437 (myl10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 168 aa AA seqDB search
MSPKKAKKKAEGASSNVFSMFDQSQIQEFKEAFTIMDQNRDGFIDKGDLRDTFAALGRIN
VKSEELDDMVQEAPGPINFTVFLTMFGEKLKGTDPEETILNAFKIFDPDGKGHIKADYIR
EMLTTQADRFTQEEITQMFTAFPPDVAGNLDYKNLCYIITHGEEKDQE
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgtcacccaagaaggcaaaaaagaaggcagaaggagcaagttcaaatgtattttccatg
tttgatcaaagtcagatccaggagtttaaagaggcttttaccatcatggaccagaacaga
gatggattcattgataaaggggacctgagagacacatttgctgctctgggacgtataaat
gtgaagagtgaagagctggatgacatggtccaggaggcaccggggccaataaacttcact
gtcttccttacaatgtttggggaaaagctaaaaggcacagacccagaggaaactatcctg
aatgctttcaagattttcgaccctgatggaaaaggccacattaaagcagattacattcgt
gagatgcttactactcaggcagaccgcttcactcaggaagagatcacccagatgtttaca
gctttccccccagatgttgctggtaacctagattataagaacctatgctatattatcacc
cacggtgaggagaaagaccaggagtaa

DBGET integrated database retrieval system