KEGG   Xenopus tropicalis (western clawed frog): 100216151Help
Entry
100216151         CDS       T01011                                 

Gene name
nup205, xnup205
Definition
nucleoporin 205kDa
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:xtr03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 2011 aa AA seqDB search
MAAQLALNSEASLWGPYREIWQTVVGALVKRQPEAIHSLDIVLKKYKPDFISLFKNPPKS
AQQHERVQKASSEGIPIKGTQRTRILEGQLIKEAFILSDLYNIGEVAAVELLLLGEQQQP
TFHGLTRGLVAILLYWDGKSCMADSLLHLIQARKGRTFTLNHSPELVSMVTRFTDDLMEQ
GLTNKILTLISQIDVNNEFDKLLKDRGLGNEKHRKEVSDLIKECRQSLAHSLYSWSCQTP
LNKEDTLLLIGYLEKVTVEGDGSLDKVNLTLLMSLLYCLDVGFLEQATDDREELIKQTSM
FMDRQYIAAIHNRLHDTQPWKLPGMQATVRLAWALALRGISQFSEVLEFSEADEPMAELA
ISGNVFLFLTEAVVGSESFCADEFFIRRIHKLVTDFLTLMPMKVKQLRNRAEEDARLIHM
SMQMGNEPPASLRRDLEHLLLLIGELYRIDPFHLELALEYWCPAEPLQSTSLMGSFLGVA
HQRPPQRQVVLSKFVRQMSDLLPATLYIPYLKMLRGLASGPQCAHYCFSLLKANGGSSAE
SLQAAGGSPVSWDHFFHSLMLYHEHLRRDLPSTDSIHLRHPPLRGITQRELDGLIACLQL
TLTIVDWSESARLALCEHAQWMPVVVILGLLQCSIPPLLKAELLKTLAAFGKSPEIAASL
WQSLEYTQILQTVRTPGLRQGVGIEVELNEIESRCEEYPLTRAFCQLISTLVESSFPTNL
GAGLRAPGFEPYLQFLRDTVFLRFRTRAYRRGAEKWEVAEAVLDVFYKLLKDYEPQPEDF
VDQYVELQGEERVAFKPPGFSLMHHLLNDSPMLELCLSLMEEGVTQLDTYAPFPGKKHLE
KAVAYCFMLLNQTLQKENRFMDLLRESHLSLIVTPLEQLLQGINPRSKKADNVINIARYL
YHGNSNPELAFESAKILCSIACNSKIQEKIVGDFTQDQNVTQKLMVGFVSCLDSEEAEEL
LDSEKEVEDQAKQTNIRYMTKIHILNLLITSLEMKAPNLAMFLLGYELKKPVSTTNLQDS
GVLGCPRTCLHSILDILRKGTDGRAGPIAIWDTPHLAELCYQVIYQLCACSDTSGPTMRY
LRTSQDFLFTQLQHLPFSVEEYEISAMNQMSWLMKTASIELRITSLNRQRSHTQRLLHLL
LDDMPTKPYSAADGEGGMEDESRSLSGFLHFDTTSKVRRKILRILDSIHFSNEIPDPLQL
DFFDRSQIEQVIANCEHKNRRGQTVCNVKLLHRVLVAEVNALQGMAAIGQRPLLMEEINT
ILQYVVERNKLLQCLHAKRHALESWRQLVEIILTACPQDLIPTEHRQLIIRDLLQDLHDK
ILDDDAAQELMPIVAGAVFTLTTHLSQSVRTELKQPMAAAGLGQSQYVQMLDGSFAAPPG
TENLSAGFASIGDSSLHMILRNLLEFILKTGGGFQRVRAHLYGSLLYYLQIAQRPDEPDT
LESAHKTMWERLTAPEDVFSKLQRDNLSIFESYGTALMEVVCRDACDGHDIGRMLALALL
DRIVSVDRQQWLLYLSNSGYLKVLVDSLAEDDMVLRNLLTPQAPLLKALYIYESKMAFLT
RVAKSQQGALELLRSGVIVRLAQCQVYDMRPETDPHGVFGMRETPVFIPAPVERYRQILL
PALQICQLILTSSTAQHLQAAGQVLQFLIAHSDTIQAILRSQEGSLGSLQELALLTGIIS
KAALPGVLNELDIGLNEGSMMELQGHIGRFQRQCLALLNRFGGSDRLRQLSLQDDSSQPD
GVSKRDDMELAMQQICSNVMEYCQTLMIQNSPSFQQTVCLFTPNLTESSSRDGTRQDSQV
SILPSWRLPGLGIVIHLLKQSANNFFTYYDIHRQSVSKLQNVEQLPPDEIKELCQSEMPV
GVDKISTTQKYALARRRLVKLINSRAKLLSLCSYIIETCLFILWRHLEHYLLHCTTSDSQ
DPVFSNTTFGNRRFQDTINTDPNMDLRNLRQNKVSQQEIDMLLREGANSFGESLQKRLLD
IESLYCKVRSRHSFIQALVRRIRGLLRVSRA
NT seq 6036 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgcagttggcgctaaattcagaagccagcctgtggggcccttatagagaaata
tggcagaccgtggtgggggcgcttgtgaagaggcaaccggaagccattcattcgctcgat
atcgtcttaaagaaatataaaccggacttcatctctctcttcaaaaatccaccaaagagc
gctcagcaacatgaaagagtgcagaaagccagcagcgaggggattcctattaaagggacg
cagcggacccggatcctggaaggacagctcattaaggaagccttcatccttagcgacctg
tataatatcggagaggtggcagccgtagaacttctacttttaggtgagcagcagcagcct
accttccatggcctgacgaggggcttggtagccatactgttgtactgggatggaaagagc
tgcatggctgattccttattacacctcatccaggcaagaaaaggcaggaccttcaccttg
aatcacagccccgagcttgtgtccatggtaactcgtttcaccgatgatctaatggagcaa
ggcttgactaataaaatcctcaccttgatctctcaaattgacgtgaacaatgagtttgac
aagttgctgaaggatcggggcctgggcaacgagaagcatcggaaagaggtttctgatctg
ataaaggaatgtcggcagtcgctcgcacacagcctgtattcatggagttgccagacacca
ctaaacaaagaagatacactacttttgattggatacttggaaaaagtaacagtagaagga
gatggctcattggacaaagtgaacttgaccctactgatgtcacttctctattgcttggat
gttggctttttggagcaagcgacagatgatcgagaagaactgataaagcagaccagcatg
ttcatggacagacagtacattgccgccatccataaccgcctgcacgacactcagccgtgg
aagctgccgggaatgcaggctacggtcagactcgcttgggccctggctcttcgagggatc
tctcagttctcagaagtcttagaattttcagaagcagacgagccaatggcagagctagcg
atcagcggcaatgtcttcctcttcctcacggaggcagtggtgggatccgaaagcttctgt
gcagatgagttctttatacgaaggattcacaaactcgtcaccgatttccttactctcatg
cccatgaaagtaaagcagctgagaaatcgtgcagaagaggatgcccgactgatccatatg
agcatgcagatgggaaatgagccccctgcttctctgcgtagggatttggaacatctgctc
ttactgatcggtgagctctaccggatagacccattccacttggaactggcgttggaatac
tggtgccccgcagagcctctccagtcgacatccttgatgggatcctttcttggtgtggcc
caccagagaccacctcaacgtcaggtcgtcttgtccaagttcgtgagacagatgagtgac
ctgctgccagccacgctctacataccttatcttaagatgctcaggggccttgcaagtggc
cctcagtgcgcccattactgtttcagtctgctaaaggccaatgggggcagcagcgcagag
agcttgcaagctgcagggggtagcccagtgtcctgggaccacttcttccactctttgatg
ctgtaccacgagcacttgcggagggatctaccaagcacagacagtatacacctgcgtcac
cctcctctccgtggtatcacccagcgagagctcgatggcctgattgcctgcttgcagctc
acccttaccatcgtcgattggagtgaaagtgcccgccttgctctgtgtgagcatgcccag
tggatgccagtggtcgttattcttggcctcctgcagtgcagcatcccaccactccttaag
gctgagctcctgaagacactggctgcatttggcaaatccccagagatcgcagcatccctc
tggcaatccctcgaatatacacagattttgcagactgtaagaaccccagggctacggcaa
ggagtcgggattgaggtggaactgaatgagatcgagtctcggtgtgaggagtaccccctg
accagagcattctgccagctcattagcactttagtggagagctccttccccaccaatctg
ggagcgggtttgagagcacccggctttgagccatacctccagtttctacgggacactgtg
ttccttcggttccgcactagagcctacaggagaggcgcagaaaagtgggaggtagcagag
gctgtactggatgtcttctacaagcttttgaaggactatgagccccagcctgaagacttt
gtggaccagtatgtggaactccaaggagaagaaagagttgctttcaagcccccggggttc
agcctcatgcatcaccttctcaatgattctccgatgctggagctctgcctcagcctcatg
gaagagggggtcacccagctggacacttacgccccttttccaggcaagaaacacctagag
aaagcagtggcttattgtttcatgctcctcaatcagactctgcagaaggagaatcgcttc
atggatttgttgagggaaagtcacctgtcgttgattgtgacccctctggagcagctcctg
cagggaattaacccacgatccaagaaagctgataatgtcatcaatattgctcgatatctc
taccatgggaacagcaatcccgagcttgcctttgaaagtgcaaagatcttatgcagcatc
gcctgtaactccaagatccaagaaaagattgtaggagactttacccaagatcagaacgtg
acccagaagctgatggttgggtttgtttcatgcctggacagcgaggaagcagaggagtta
ctggattcagagaaagaggtggaggaccaagccaagcagacgaacatccggtacatgaca
aagattcacatcctcaatcttctgatcacctccctggaaatgaaagcccccaaccttgcc
atgttccttctcggctacgaactgaagaagccagtcagcacgaccaacctgcaggactct
ggtgtcctgggctgcccgcggacctgccttcactccattttagacatcttgagaaagggg
actgatgggcgggctggacccatagccatatgggatactcctcatcttgctgaactgtgt
taccaggtgatctaccagctgtgcgcttgttcagatacctctggccccaccatgagatac
ctacggaccagccaggatttcctcttcactcagcttcagcacctgcccttctctgtggaa
gagtatgagatctccgccatgaatcagatgtcctggctgatgaagacggcgtccatagaa
ctgcgcatcacctccctaaaccgccaacgttcccacacgcagaggctccttcacctgctg
cttgacgacatgcccaccaaaccgtattcagcagctgatggcgaaggaggaatggaggac
gaaagccgcagcctcagtggatttctgcactttgacactacctcaaaagtccgccggaaa
atcctccgcatcctggactccatacatttcagcaatgagatcccggatcccctgcagttg
gatttcttcgatcgcagccagatagagcaggttattgctaactgcgagcacaagaaccgc
agagggcagaccgtctgcaacgtcaagcttctccatcgggttctggttgcagaagtgaat
gcccttcagggaatggctgctattggtcagaggccgctgcttatggaggaaatcaacacc
atccttcagtacgtggtggaaaggaacaagctgctgcagtgcctccacgccaaacgccat
gcgctggaatcatggcggcaacttgtggagatcatactgaccgcctgtccccaggacctc
attccgactgagcacagacagctcatcatacgagacctgctgcaagatctgcatgataag
atcctcgacgacgacgctgcccaagaactaatgcccattgtcgccggggcagtcttcacc
ctcaccactcatctcagccaatctgtacgtaccgagctgaaacagccgatggctgccgct
gggctgggccagtcgcaatatgtgcaaatgctggacggctcattcgctgcccctcctggg
acagaaaacctctccgctggttttgcatccattggagactcctcccttcacatgattctc
aggaatctgctcgagttcattctaaaaacaggaggtgggttccaacgggtcagggcccac
ctgtacggatcgctgctgtattacctgcagatagctcagagaccagatgaaccagatact
ctggaatccgcacacaagactatgtgggagcgactgacggccccggaggatgtattcagc
aagctgcagcgagacaacctgtccatattcgagagctacggcaccgcccttatggaagtg
gtttgccgggacgcctgtgacggacatgacattgggaggatgctggccctggcactgctt
gaccggattgtctctgtggataggcaacagtggctgctttatctctccaacagtggctac
ctgaaggtccttgtggatagcctggcagaggacgatatggtcctaaggaacctgctaact
cctcaggcgcctcttctaaaggctctctatatctatgagtcgaaaatggcatttctgacc
cgggtggctaaaagccagcagggagccctggagctgctgaggagtggggttatcgtcagg
ctggcacagtgccaagtatatgatatgcgcccggagactgacccccatggagtgtttggc
atgagagagaccccggtgtttatccccgccccggtggaacgataccggcaaatcctgtta
cccgctctccagatctgtcagctcatcctgacctccagcacggcacagcacttacaggcc
gccggacaggtcttgcagttcctgatcgctcattctgataccatccaggcaattctccgg
agccaggaggggagtctgggttccttgcaggagttggctttgcttacaggcatcatcagc
aaggccgcactacccggtgttctcaacgagctcgatatcggtttaaacgaagggtccatg
atggagttacaaggacatattggccgcttccagcgccagtgtcttgcgttattaaaccgc
tttggggggtccgaccgacttcggcagctcagtctgcaggatgattcctcccagccggac
ggtgtgagcaagagggacgacatggagttggccatgcaacagatctgctccaacgtgatg
gagtactgccagacgcttatgatacagaactcgccaagcttccagcagactgtgtgtctc
ttcacccccaacctcacggagagctccagccgagatggaacacggcaggattcccaggtg
tccattctgccgtcatggcggttgccaggcttgggtatagtgatccaccttctgaagcag
agcgccaataacttcttcacttactatgatatccaccggcagagcgtcagcaagctgcag
aacgtggagcaactcccgcccgatgagattaaagagctgtgccagtctgagatgccggtt
ggcgtagataaaatctcgacgacgcagaagtacgcgctggcacggcggcgactcgtgaag
cttatcaacagcagagccaaactgctttctctttgtagttatatcatagaaacgtgtctg
ttcattctgtggcgccacttggaacattaccttctgcactgcaccaccagcgactcccag
gaccccgtcttctcgaatacgaccttcggcaacagaaggtttcaagatacaattaacact
gatcctaacatggacctgaggaacctgagacagaataaagtcagccaacaggaaattgat
atgctgctaagagaaggcgccaatagtttcggggagtccctgcagaagagactgttagac
atcgaatcattgtactgcaaggtgcgatcccgtcacagcttcatccaggcgctggtcagg
cggatccggggcctcctgcgagtatcaagggcctga

DBGET integrated database retrieval system