KEGG   Xenopus tropicalis (western clawed frog): 100486062Help
Entry
100486062         CDS       T01011                                 

Gene name
usp18
Definition
ubiquitin specific peptidase 18
Orthology
K11846  
ubiquitin carboxyl-terminal hydrolase 18/41 [EC:3.1.2.15]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 333 aa AA seqDB search
MQDEGYASCCSLLEEEEANQAGQARAVTAPVERLSYSGGKFKNGAVGLCNIGVNNCLNPL
LQTLYMNQHFTDLLCGIGHPNDNVPAERRLPYELLALFEEMQNSKEDAVAPYRFLRCLQI
LDTRLCEQHDAADFLFMMWNLLLQQMPLPHLAQRLRALYGIKLKEHVTCHKCSHEKSSDM
EVLTIPLPVPHSKYQRPLPLVLQFFSLPQTLSIHLKRISRRKTSDVQKINRTFSFPCTLD
LSDVLDQEQFPVQEHAQSDFKYRLFAVIAHSGTASFGHYCAYINSSKDQTWYSFNDSSVC
KVSWDDVKCTYGNMDFHFSATACLLVYLQGDGN
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgcaggacgaaggatacgccagttgctgctccttattggaggaagaggaggccaatcaa
gccggccaggcgcgggcagtaactgcccctgtggagcgattgtcctatagtggtgggaaa
ttcaaaaacggggcagtcggactgtgcaatatcggggtaaacaactgtctgaacccgctg
ctacaaactctatacatgaaccagcactttacagacttactctgtgggattgggcaccca
aatgacaatgtccccgcagagaggaggctgccatacgagctgctggccctgttcgaggag
atgcagaatagcaaggaggacgccgttgccccctacagattcctacgctgcttacagatt
cttgatacaagattgtgtgaacaacacgacgctgccgactttctgtttatgatgtggaat
ttacttcttcaacagatgcccctcccacacctggcacagaggctgagggcactttatggc
atcaaacttaaagaacacgtgacgtgccacaaatgctcccatgaaaagtccagtgacatg
gaagtcctgacaattccgttgccagttccccactccaaataccaaaggcctttgcccctg
gttctccagttcttctctctacctcagacgctgtccatacatctgaaacgtattagcaga
agaaagacctccgacgtacagaagataaacagaacgttctctttcccttgcacgctggac
ttgagtgatgttctggatcaggagcagttcccggtacaagaacatgctcagtcagacttc
aagtatagactttttgctgtcatcgcccactctggaacggccagctttggccactattgt
gcctacatcaatagctcaaaggaccagacgtggtacagctttaatgactccagcgtttgc
aaggtatcctgggatgatgtgaaatgcacctatggaaacatggactttcacttcagtgct
acagcctgtctgctggtctatctacagggagatgggaactag

DBGET integrated database retrieval system