KEGG   Xenopus tropicalis (western clawed frog): 100487524Help
Entry
100487524         CDS       T01011                                 

Gene name
ren
Definition
renin
Orthology
K01380  
renin [EC:3.4.23.15]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Renin-angiotensin system
Class
Organismal Systems; Endocrine system; Renin-angiotensin system [PATH:xtr04614]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 392 aa AA seqDB search
MYCLPLFYLFMVTCDCFRRIPLNRMPSIRETLQSMGVKVTDAFPQLRMKALADKNPNNGT
APTVLTNYMDTQYFGEISIGSPPQTFKVVFDTGSANLWVPSQRCSPLYSACVSHNRYDST
KSQTYMENGAGFSIQYGSGGVKGFLSQDVVVVAGIPVIQVFAEATALPAFPFIFARFDGV
LGMGFPGQAIDGITPVFDRIISEQVLQEDVFSVYYSRDSHLKPGGEIILGGSDPSYYTGS
FQYLNLEKEGYWHIRMKGVSIGAEILFCKDGCSVAIDTGAAYITGPASSVSVLMKAIGAT
ELAEGEYTVDCDKISQLPDVSFHMGGNEYTLKGPAYILQQSQFGEEICSVAFTPLDIPPP
VGPLWILGASFIGQYYTEFDRRNNRIGFATSL
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgtattgtctacccttattctacctcttcatggtaacctgtgactgcttcagaaggatt
ccactcaatagaatgccatcaatacgggaaactttgcagagcatgggggtgaaagtaact
gatgcttttcctcagctgaggatgaaggcactggcagataagaatcctaataatggaaca
gctccaactgtgcttaccaactacatggatacacagtattttggtgagatcagtataggt
tctccgccacaaacattcaaggtagtctttgatacaggatctgccaatctgtgggtgcca
tcacaacgctgctcccccctctacagcgcctgtgtatcacataacagatatgattccact
aagtcccagacgtacatggaaaatggggcaggcttctctattcaatatggctcaggggga
gtgaaaggattcttgagccaggatgttgtggtggtagcaggcattccagttatacaagtt
tttgctgaagctacagcacttccagcctttccatttatctttgcccgctttgatggagtc
ctgggaatgggctttcctggccaggccattgatggcattacccctgttttcgatcggatc
atatcagagcaagtcctgcaggaggatgtcttttctgtatattacagccgggattctcac
ctaaaaccaggaggtgaaattattttaggaggttcagacccttcttactacacggggagc
ttccagtatctcaacttagagaaggaaggatattggcacatcagaatgaagggggtgtcc
attggggcagagatcttattttgtaaagatggttgctcagtagcaattgacacaggagca
gcttacatcactggtccagctagttcagtttctgtcctcatgaaggccattggcgctact
gaattggcagagggagagtacactgtggactgtgataaaatttctcagcttcctgacgtc
tccttccacatgggtgggaatgagtatacgctgaagggacctgcatatattctgcagcag
tcccagtttggggaagagatatgctcagttgcttttactcctctggatattcctccacca
gtcggaccactctggatcctgggtgcctcattcataggccagtattataccgaatttgac
cggcgcaacaaccggattggatttgcaacatctctctga

DBGET integrated database retrieval system