KEGG   Xenopus tropicalis (western clawed frog): 100487524Help
Entry
100487524         CDS       T01011                                 

Gene name
ren
Definition
renin
Orthology
K01380  
renin [EC:3.4.23.15]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Renin-angiotensin system
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Organismal Systems
  Endocrine system
   04614 Renin-angiotensin system
    100487524 (ren)
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.15  renin
     100487524 (ren)
Peptidases [BR:xtr01002]
 Aspartic Peptidases
  Family A1: pepsin family
   100487524 (ren)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 392 aa AA seqDB search
MYCLPLFYLFMVTCDCFRRIPLNRMPSIRETLQSMGVKVTDAFPQLRMKALADKNPNNGT
APTVLTNYMDTQYFGEISIGSPPQTFKVVFDTGSANLWVPSQRCSPLYSACVSHNRYDST
KSQTYMENGAGFSIQYGSGGVKGFLSQDVVVVAGIPVIQVFAEATALPAFPFIFARFDGV
LGMGFPGQAIDGITPVFDRIISEQVLQEDVFSVYYSRDSHLKPGGEIILGGSDPSYYTGS
FQYLNLEKEGYWHIRMKGVSIGAEILFCKDGCSVAIDTGAAYITGPASSVSVLMKAIGAT
ELAEGEYTVDCDKISQLPDVSFHMGGNEYTLKGPAYILQQSQFGEEICSVAFTPLDIPPP
VGPLWILGASFIGQYYTEFDRRNNRIGFATSL
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgtattgtctacccttattctacctcttcatggtaacctgtgactgcttcagaaggatt
ccactcaatagaatgccatcaatacgggaaactttgcagagcatgggggtgaaagtaact
gatgcttttcctcagctgaggatgaaggcactggcagataagaatcctaataatggaaca
gctccaactgtgcttaccaactacatggatacacagtattttggtgagatcagtataggt
tctccgccacaaacattcaaggtagtctttgatacaggatctgccaatctgtgggtgcca
tcacaacgctgctcccccctctacagcgcctgtgtatcacataacagatatgattccact
aagtcccagacgtacatggaaaatggggcaggcttctctattcaatatggctcaggggga
gtgaaaggattcttgagccaggatgttgtggtggtagcaggcattccagttatacaagtt
tttgctgaagctacagcacttccagcctttccatttatctttgcccgctttgatggagtc
ctgggaatgggctttcctggccaggccattgatggcattacccctgttttcgatcggatc
atatcagagcaagtcctgcaggaggatgtcttttctgtatattacagccgggattctcac
ctaaaaccaggaggtgaaattattttaggaggttcagacccttcttactacacggggagc
ttccagtatctcaacttagagaaggaaggatattggcacatcagaatgaagggggtgtcc
attggggcagagatcttattttgtaaagatggttgctcagtagcaattgacacaggagca
gcttacatcactggtccagctagttcagtttctgtcctcatgaaggccattggcgctact
gaattggcagagggagagtacactgtggactgtgataaaatttctcagcttcctgacgtc
tccttccacatgggtgggaatgagtatacgctgaagggacctgcatatattctgcagcag
tcccagtttggggaagagatatgctcagttgcttttactcctctggatattcctccacca
gtcggaccactctggatcctgggtgcctcattcataggccagtattataccgaatttgac
cggcgcaacaaccggattggatttgcaacatctctctga

DBGET integrated database retrieval system