KEGG   Xenopus tropicalis (western clawed frog): 100487551Help
Entry
100487551         CDS       T01011                                 

Gene name
usp32
Definition
ubiquitin specific peptidase 32
Orthology
K11837  
ubiquitin carboxyl-terminal hydrolase 6/32 [EC:3.1.2.15]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1597 aa AA seqDB search
MGAKESRIGFLTYDEAVKRVTDVELKRLKDAFKRTCGGPSYYMNQQCFIREVLGDGVPPK
VAEVIYCSFGGTSKGLHFNNLIVGLVLLTRGRDEEKAKYIFSLFSNESGSCVVREEMESM
LCMVDGEVPLSLKKCFAEGEKVNYDKFRNWLLQNKDAFTFSRWLLSGGVFVTLTDDSDTP
TFYQTLAGVTHLEESDIIDLEKRYWLLKAQSRTGRFDLETFVPLVSPPIHQSLSEGLFNA
FDENRDNHIDFKEISCGLSACCRGPLAERQKFCFKVFDIDRDGILSRTELEEMVLALLEV
WKDNRIDAIPELHLNLSNITDNILQSHDTTKIGHLTLEDYQIWSVKSALANEFLNLLFQV
CHIVLGLKPATPEEEGQIIRGWLERESRYGLQFGHNWFLISMQWWQQWKEYVRYDSKPTV
VPCSTLSGGRNLSGTTSPDQKEDDRTGSNLSFTDEKSPDNISSASEASESTTTGFTYSSN
TTSDMCFARQHNTSDNNNQCMLSANGNALLQLNPQKPGAIDNQPLVTQETVKVPSLTLEG
GRLKQSPSLLRGKDYEIVPEPVWRALYHWYGANLSLPRPVIKNCKTDLPELELFPRYLLF
LRQQPVTRQQQSNIWVNMGNVPSPNAPLKRVLAYTGCFSRMQTIKEIHEYLSQRLRIKEE
DMRLWLYNSENYLTLLDDEDHTLEGLKIQDEQHLVIEVRNKDMSWPEEMSFIANSSKIDR
HKVPTEKGATGLSNLGNTCFMNSSIQCVSNTQPLTKYFISGRHLYELNRTNPIGMKGHMA
KCYGDLVQELWSGTQKNVAPLKLRWTIAKYAPRFNGFQQQDSQELLAFLLDGLHEDLNRV
HDKPYVELKDSDGRPDWEVAAEAWDNHLRRNKSIVVDLFHGQLRSQVKCKTCGHISVRFD
PFNFLSLPLPMDSYMHLEITVIKLDGTTPVRYGLRLNMDEKYTGLKKQLSDLCGLKPEQI
LLAEVHGSNIKNFPQDNQKVRLSVSGFLCAFEIPIPGSPTSATSPTQTDPNTILLSNGPH
SLISNGGLNRPTLIPNGLPNTVVPCGTEKNLVNGVLNGHVSVHPEGPFIGYIIAIHRKMM
RTELYFLSFQKNRPSLFGMPLIVPCTVHTRKKDLYDAVWIQVSRLASPLPPQEASNHAQD
CDDSMGYQYPFTLRVVQKDGNSCASCPWYRFCRGCKIECSEDRAYIGNAYIAVDWDPTAL
HLRYQTSQERIVEEHESVEQSRRAQAEPINLDSCLRAFTSEEELGEDEMYYCSKCKTHCL
ATKKLDLWRLPPILIIHLKRFQFVNGRWIKSQKIVKFPRENFDPSAFLVPKGPIQYQKKQ
MVLQNEDQSDTRLTQVEGKKELANSVLPGDTDAACRNQPALNPSTGNNIKASPSQGRKGN
INCTSKNNSPNHSPRTLGRGKGRLRLPQIGVKKLSSSKENLDQNKENGTDNEMREGPDTV
DSNKGLCGSQGEVATVQDTEVVLTNGLNYEQNSCSNGQLENHTGEEEDSTDDQRDDIGCQ
PIYNLYAISCHSGILGGGHYVTYAKNPNAKWYCYNDSSCKELHPDEIDTDSAYILFYEQQ
GVDYAQFLPKIDGKKMADTSSMDEDFESDYKKYCVLQ
NT seq 4794 nt NT seq  +upstreamnt  +downstreamnt
atgggggccaaggagtctcggatcgggtttctgacgtatgatgaagccgtgaaaagagtg
actgacgttgaactgaagaggctgaaagatgccttcaagagaacttgtggaggaccttcc
tactacatgaatcagcaatgttttataagggaagtccttggggatggggtcccccctaag
gttgcagaggtcatctattgctcatttggtggaacctccaaagggttacatttcaacaac
ctgatagtgggacttgtccttctaacaagaggtcgagatgaagagaaggcaaaatacatt
tttagtctcttttcaaatgaatctggcagctgtgttgtacgagaggaaatggagagcatg
ctgtgcatggtggatggagaagttcctctgtcacttaagaaatgttttgctgagggtgaa
aaggtgaactatgacaaatttcgaaactggctactgcagaataaggatgcatttacgttt
tctcgatggttgctttctggaggagttttcgttaccctcacagatgatagtgacactccc
actttttatcagactttagctggagttacacacttggaagagtctgacatcatcgatctg
gagaaaagatactggttattgaaggcacagtcacgtactggacggttcgatttagaaaca
tttgtccccttggtttcacctcctattcatcagtccttgagtgaagggttattcaatgcg
tttgatgaaaaccgggacaatcacattgacttcaaagaaatttcgtgtgggctgtctgca
tgttgcaggggacccctagctgagagacaaaaattttgtttcaaggtatttgacatagat
cgtgatggtattctgtctcgcacggagctggaagagatggtccttgcgcttttggaggtt
tggaaggataaccgtattgatgccatacctgaattgcacttaaatctgtctaacatcaca
gacaatatactgcagtcccatgatacaacaaagattggacatctgacactggaagattat
cagatatggagtgttaaaagtgcccttgccaatgagtttttaaatcttctttttcaggtg
tgtcatatagtcttggggttaaaaccagccactcccgaggaggaaggacaaattattaga
ggttggctagaaagagaaagtcggtatggactacagtttggtcacaactggtttcttatc
tctatgcagtggtggcagcagtggaaagaatatgtcagatatgattctaagccaactgtt
gtaccatgctctacattaagtgggggaaggaatttatcaggtacaacctcaccggatcaa
aaggaagatgacaggactgggtcgaacttaagttttacagatgaaaaatcaccagataac
atatcatctgcttcagaagcttcagaatcaactacaaccggtttcacttattcgagcaat
acaacctcagacatgtgctttgcacgtcagcataacacttcagataataataaccagtgt
atgctcagtgccaatgggaatgcattattgcagcttaatccacagaaacctggagctatt
gacaaccagcctctagttacacaagaaactgtaaaggttccttccttaacacttgaaggg
gggcgactaaaacagagtccatctctgctccgaggtaaagactatgagattgttccagag
cctgtgtggagagccttgtatcactggtatggggcaaacctttccttaccacgtccagtt
atcaaaaactgcaaaacagatcttccagaacttgagcttttcccacgctatttgcttttc
ttgagacagcagcccgtaactcgccaacaacagtcaaacatctgggtgaatatgggtaat
gttccctcgccaaatgctccactgaaacgtgtgctggcatacactggctgtttcagccgc
atgcagacaataaaagaaattcatgaatatctttctcagcggctgcgcattaaggaagaa
gatatgaggttgtggttgtataatagtgagaattacctcactttacttgatgatgaagac
cacacattagagggcctgaaaatacaagatgagcagcacttggtaatagaagtcaggaac
aaagacatgagctggcctgaagagatgtcatttattgcaaacagcagtaaaattgataga
cataaagttccaacagaaaaaggtgccacgggtctgagcaacttagggaacacatgcttt
atgaattcaagtatccaatgtgttagcaacacacagccacttactaaatattttatctca
ggaaggcatttgtatgagctcaacagaacaaatcctattggaatgaaaggacacatggca
aaatgttacggtgatttggtacaagagctgtggagtggaacccagaaaaatgtggcacct
cttaaattacggtggacaatagcaaaatatgcaccaaggttcaatggctttcaacagcag
gattctcaggagctgctagcttttcttttagatggtcttcatgaagatctgaaccgagtt
cacgacaaaccttacgttgaactcaaagacagtgatggtcgcccagactgggaagttgct
gcagaggcatgggataaccatttaaggagaaacaaatcaatagttgtggatttgtttcat
ggacagctgagatcccaagtgaaatgtaaaacatgtggacacataagtgtaagatttgat
cctttcaactttctttcgctccctcttcccatggacagctatatgcacttggaaattaca
gttattaaactagatggtacaacccctgtgcgatatggactcaggctgaacatggatgag
aaatacacaggcttgaaaaaacagcttagtgacctgtgtggattaaaacctgagcagatt
ctccttgcagaggttcatggatccaacataaagaattttccccaggataaccaaaaagtt
cgcctttctgtaagtggttttctgtgtgcttttgagatacctattccaggatctccaaca
tctgccacaagtcccacacagacagatcccaacacaatactattatcaaatgggccgcac
agtctaatctcaaatggaggactgaatcgaccaacactaattcctaatgggctgccaaac
acagtagtgccatgtggaacagaaaaaaatctggtgaatggagttcttaatggtcatgtc
tctgtgcatccagaaggtcccttcatagggtatatcattgcaatccacagaaagatgatg
aggactgagttgtactttttgtcatttcaaaaaaatcgccccagcctttttggaatgccc
ttaattgtcccatgcacggtgcacacaagaaaaaaagacttgtacgatgccgtttggatt
caggtttccaggcttgcaagtcctcttccgccacaggaagcaagtaaccatgcacaagac
tgtgatgatagcatggggtatcagtatcctttcactctgcgagtggttcagaaagatggt
aattcatgtgcttcttgcccttggtacaggttctgtagagggtgtaaaattgaatgttct
gaggatcgggcttatatcggcaatgcatacattgctgtggattgggaccccactgcactt
catcttcgctaccagacatcgcaagaacggattgttgaagagcatgagagtgttgaacag
agtcgtcgagcacaagctgagcctataaacctcgatagctgtctcagagctttcactagt
gaggaggaacttggagaagatgaaatgtattattgttccaaatgtaaaacccactgttta
gccaccaaaaaacttgacctttggagacttccaccgatcttgataatccacttgaaaaga
ttccagtttgtaaatgggcgctggataaagtctcagaaaatagtaaaatttcctcgagag
aactttgatccgagtgcctttttggttcctaaaggaccaatacagtaccagaaaaagcaa
atggtgcttcaaaatgaagatcagtcagacacacgtctaacccaggtggaagggaagaag
gagcttgcaaactctgtccttcccggagatacagatgcagcttgccgaaatcagcctgcc
ctcaacccctcaacggggaataatatcaaagcttccccctctcaaggaagaaaagggaat
atcaactgcacaagcaaaaataatagcccaaaccatagccccagaactctaggaaggggt
aaaggtcgtcttcgtttgcctcagatcggagtcaaaaaactttcaagtagcaaagaaaat
ctggatcaaaacaaagaaaatggcactgataatgaaatgagagaaggtccagatactgta
gattccaataaggggctttgtggaagtcaaggggaggttgccactgttcaggatacagag
gtggtcttgaccaatgggcttaattatgaacaaaactcatgcagcaatgggcagctggaa
aaccacacaggggaagaagaggacagcactgatgaccaaagagatgacattggctgtcaa
cctatttacaacctttatgcaatttcgtgccattcaggaatattgggtggaggtcattat
gtcacttatgccaaaaatccaaatgcgaaatggtactgctacaatgacagcagctgcaag
gaattgcaccctgatgaaattgacacagactctgcgtacatccttttctacgaacagcaa
ggggtggactatgcacaatttctgccaaagatagatgggaaaaagatggcagacactagc
agcatggatgaagattttgaatccgactataaaaaatattgcgtgctgcaatga

DBGET integrated database retrieval system