KEGG   Xenopus tropicalis (western clawed frog): 100492289Help
Entry
100492289         CDS       T01011                                 

Definition
protein unc-13 homolog A-like
Orthology
K15293  
protein unc-13
Organism
xtr  Xenopus tropicalis (western clawed frog)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1687 aa AA seqDB search
MSLLCVGVKKATFDGAQEKFNAYVTLKVQNVKSTTIAVRGNQPCWEQDFMFEINRLDLGL
TVEVWNKGLIWDTMVGTVWIPLRTIRQSNEEGPGEWLTLDSQVIMTDNEICGTKDPTFHR
ILLDTRFELPLDIPEEEARYWAKKLEQLNAMRDQDDYVFQEEIPENPLPVHGSQCCNWNY
FGWGEQHNEDPDSAVDDRDSDYRSETSNSIPPPYYSTSQPNASVHQYPVRQQHSSHGSYT
DSVHSYEMDFSDHRPISPTGSSRYASSGEISRGSSQLSDDFDPDDDSLQGSEIEEERDRD
SYHSCHSSVSCRKDSPNWEGEEEREVYSEDEEEYPDSRGQLSDQELYDDDQLEEEEKKGR
LAYGQEDSIYQSLEAEEKEPLDIPLEKDRTPEAVPEEVVEPTVPAVQSPQAKVCKXTFCY
SYREEEPGMSRAKSNWLRAFNKVRLQLQEARGEGTGEMSKSLWFKDGPAGGLIIIDSMPD
IRKRKPIPLVSDLAMSLVQSRKAGITSALATSTLNNEELKNHVYKKTLQALIYPISSTTP
HNFEVWTATTPTYCYECEGLLWGIARQGMRCTECGVKCHEKCQDLLNADCLQRAAEKSSK
HGAEDRTQNIIMVLKDRMKIRERNKPEIFELIQEVFGVLKATHAQQIKAVKQSVLDGTSK
WSAKISITVVCAQGLQAKDKTGSSDPYVTVQVGKTKKRTKTIYGNLNPVWEENFHFECHN
SSDRIKVRVWDEDDDIKSRVKQRFKRESDDFLGQTIIEVRTLSGEMDVWYNLDKRTDKSA
VSGAIRLHISVEIKGEEKVAPYHVQYTCLHENLFHYLTDVQNNGVVKIPDAKGDDAWKVY
FDETAQEIVDEFAMRYGVESIYQAMTHFACLSSKYMCPGVPAVMSTLLANINAYYAHTTA
STNVSASDRFSASNFGKERFVKLLDQLHNSLRIDLSMYRNNFPASSPERLQDLKSTVDLL
TSITFFRMKVQELQSPPRASQVVKDCVKACLNSTYEYIFNNCHELYSREYQSDPAKKGEV
PPEEQGPSIKNLDFWSKLITLIVSIIEEDKNSYTPCLNQFPQELNVGKISAEVMWSLFAQ
DMRYAMEEHDKHRLCKSADYMNLHFKVKWLYNEYVTELPSFKSKVPEYPAWFEPFVIQWL
DENEEVSRDFLHGALERDKKDGFQQTSEHALFSCSVVDVFSQLNQSFEIIKKLECPDPQI
VGHYMRRFAKTISNVLLQYAEIISKDFASHCSKEKKEEKVPCILMNNIQQLRVQLEKMFE
AMGGKELDAETSDILKELQVKLNNVLDELSRVFTTSFQAQIEECVKQMGDILSQVKGTGN
VPASNCSSVAQDADNVLQPILDPLDSNLTLFAKICEKTVLKRVLKELWKLVMNTMEKTIV
LPPLTDQTMIGTLLRKHGKGIEKSRVKLPYHADGTHLIINAAKELGQLSKLKDHMVREEA
KSLTPKQCAVVELALDTIKQYFHAGGVGLKKTFLEKSPDLQSLRYALSLYTQATDTLIKT
FVQTQSAQGSGVDDSVGEVSIHVELFTHPGTGEHKISVKVVAANDLKWQTSGIFRPFIEV
NMIGPNLSDKKRKFTTKSKNNSWAPKYNESFQFTLGNETGPESYELQVCVKDYCFAREDR
TVGMAVMQLRDLAQRGSCACWLPLGRRIHMDETGLTILRILSQRNNDEVAKEFVKLKSDT
RSPEEGS
NT seq 5064 nt NT seq  +upstreamnt  +downstreamnt
atgtctttgctttgcgtgggagtaaaaaaggccacgtttgatggagcacaagagaagttt
aatgcctacgtaaccttgaaggtgcaaaatgtgaagagcacaacgatagcggtgcgggga
aaccagccctgctgggaacaggatttcatgtttgagattaatcgtttagaccttggtcta
acagtggaggtctggaacaaaggattgatctgggacaccatggtgggaacagtatggatt
cctttaaggacaatccgacaatccaatgaggagggtcctggggaatggctgacacttgat
tcacaggtcataatgacagataatgagatttgtggtaccaaagatccaaccttccaccgc
atcttactggatacccgatttgagcttcctctagatataccagaagaagaagctcgatac
tgggcaaagaaactcgagcaacttaatgcaatgagggaccaggatgattatgtttttcaa
gaagaaattccggagaatcctcttcctgtccatggatctcaatgttgtaactggaattat
ttcggctggggggagcagcacaatgaggatcccgatagtgcagtggatgatcgggatagt
gattaccgcagtgaaaccagcaacagtatcccgcccccctactactccacctcacagcct
aatgcctctgtgcaccagtaccctgtacgacagcaacacagttctcatggatcttacact
gattcagtgcacagctatgagatggacttctctgaccatcgtccaatcagccccactgga
agtagtcgatatgcttcatcaggggagattagtcgtggctcctcacagctcagtgatgac
tttgacccagatgatgacagcttgcaaggttcagaaatagaggaagaaagggatagagac
tcttatcactcctgtcatagttctgtcagctgccgcaaggactcgccaaattgggaagga
gaggaggagcgtgaagtttatagtgaagatgaggaagaatatcctgacagtagggggcag
ctctctgaccaggagctgtatgatgatgaccagcttgaggaagaagagaaaaaaggaaga
ttagcatatgggcaggaggattccatctatcagtcattggaggctgaggagaaggaaccc
ctggatattccattggagaaggacaggacaccagaagctgtgccagaggaggtagtagag
ccaacagtaccagcagtccagtctccccaagctaaagtgtgtaaatgaactttttgctac
agttacagagaagaagaacctggaatgtccagggccaaatctaattggttaagagcattc
aacaaggtgcgcctgcagctgcaagaggcacgaggtgaagggactggggagatgtccaaa
tccctctggtttaaggatgggccagctggtggtcttataattatagacagtatgccagac
atacgaaagaggaaaccaatcccgttggtcagtgacctggcaatgtcactggttcagtca
cggaaggctgggattacttctgctcttgcaacaagcaccttaaacaatgaagagctaaaa
aaccatgtttacaaaaagaccctgcaagctttaatatacccaatatccagcaccactccc
cacaactttgaagtttggactgccacaactcctacctattgttatgaatgcgaagggctt
ctgtggggaatcgctcggcagggcatgcgttgcacagagtgtggtgtcaagtgccatgag
aagtgccaggatctgctgaatgcagattgtcttcaaagagctgcagagaagagctcaaaa
catggtgcagaagaccggactcagaatattattatggtcttgaaggatcgtatgaagatc
cgggagaggaacaagccagaaatatttgagctgatccaggaagtatttggggtattaaag
gctacacacgctcagcagataaaggctgtgaaacagagtgtgctggatggtacttccaaa
tggtcagcaaagatcagcataactgttgtatgtgcacagggtctacaggccaaagataag
acaggctccagtgacccatatgttactgttcaagttgggaaaaccaagaaaagaaccaaa
acaatctatggaaatcttaatcctgtctgggaagagaattttcactttgaatgccacaac
tcctcagatcgtattaaagtacgcgtgtgggatgaagatgatgatatcaaatctcgtgtg
aagcagagatttaaaagagaatcagatgacttccttggacaaacaattattgaagtcaga
acacttagcggagagatggatgtgtggtataacttggataagagaacagataaatccgct
gtctctggggcaatccgtcttcatataagtgtggaaataaaaggagaggaaaaggtggct
ccctatcacgtgcaatacacatgtctacatgagaacttattccattacctgacggatgtg
cagaataatggtgtggtcaagattccagatgcaaaaggagacgacgcctggaaagtttat
tttgatgagacagcccaggaaattgtggatgaatttgcaatgagatatggagtggagtcc
atataccaggccatgacgcattttgcctgcctttcatctaaatatatgtgtccaggagta
ccagctgtaatgagtactcttcttgccaacattaatgcttactatgcgcacacaactgca
tctactaatgtgtctgcctccgaccgattctctgcctcaaactttgggaaggagagattt
gtaaagctgcttgaccagttgcacaattccttacgcattgacctgtccatgtatcggaac
aacttccctgctagcagccctgaaagactccaagatctcaagtccactgtagatttacta
actagcataacatttttccggatgaaggtacaagagcttcagagcccaccacgggcaagc
caagttgttaaggactgtgtgaaggcatgccttaactcaacctacgaatatatctttaac
aactgccatgaactttatagccgagaatatcaaagtgaccctgctaaaaaaggggaggta
cccccagaagaacaggggccaagtataaagaacttagatttttggtccaaactaatcaca
ttgattgtgtctatcatagaggaagataagaactcatatacaccttgtctaaaccagttt
cctcaggagctaaatgttggtaagattagtgctgaggtcatgtggagtctctttgctcaa
gacatgagatatgctatggaagaacacgacaaacaccgcctgtgtaagagtgcagactac
atgaacttgcattttaaggtcaagtggttgtacaatgaatatgtaactgagctaccatct
tttaagagcaaggttccagaatatcccgcctggtttgagccttttgtaattcagtggctg
gatgaaaatgaagaggtctcccgggattttctgcatggagcacttgaaagagataagaag
gatgggttccagcagacctctgaacatgccctgttctcctgctctgtggtagatgttttc
tcacaacttaaccagagctttgagatcattaagaagttggagtgtccagacccacaaatt
gtggggcattacatgcgtagatttgccaagacgatcagtaatgttctgctgcagtatgct
gaaattatttccaaagattttgcatctcattgctccaaagagaagaaagaagaaaaagtg
ccctgtattcttatgaacaatatccagcaacttcgagtgcaactagaaaaaatgtttgaa
gcaatgggaggaaaggagctggatgcagaaacaagtgacattcttaaagagctgcaggtg
aaactcaacaatgtcctagatgagctaagcagagtgtttaccaccagttttcaggcacaa
attgaggagtgtgtgaagcagatgggtgacattctgagccaggtaaaagggaccggaaat
gtaccagccagtaactgcagcagtgtggctcaggatgcagataatgtattgcagcctatc
ctggatcctctggacagcaacctgacactatttgccaagatctgtgaaaagacagtcctg
aagcgggtactaaaagaactctggaagcttgtgatgaatacaatggagaaaacgattgtc
cttccaccactaacagaccaaacaatgatagggacgctgctgagaaaacatggcaaggga
atagagaagagcagggtgaagctgccgtaccacgcagatggaacccaccttatcattaat
gcagccaaggaactgggccagttatccaaactaaaggatcacatggtgcgagaggaagcc
aagagcctcacccctaagcagtgtgcagtggtggagcttgcacttgatacaattaagcaa
tatttccatgctggaggtgttggtctcaagaagacattcctggagaagagtccagaccta
caatctctacgctatgcactttctctttacacacaagcaaccgatacgctaatcaaaacc
ttcgtccagacacagtctgctcagggatctggggtggatgattctgttggggaagtttct
atccatgtggagttatttactcacccaggaacaggcgagcacaagatcagcgtaaaggtt
gtagcggccaatgaccttaaatggcagacgtcagggattttccgtccctttattgaggta
aacatgattggtccgaatctgagtgacaaaaaaaggaaatttaccaccaagtccaagaac
aacagctgggccccaaaatataacgagagcttccaatttaccctgggtaatgagactggt
ccagagagttatgagctgcaagtatgtgtgaaagattactgttttgctcgggaagaccgc
acagtgggaatggctgtcatgcaactgcgagatctggcacaaaggggtagctgtgcctgt
tggctccctcttggccgccgcattcatatggatgagacaggactgaccatcttgcgcata
ctatcacaaagaaacaatgatgaggtggccaaagagtttgtcaaactcaaatctgacacc
cgctctccagaagaggggagctag

DBGET integrated database retrieval system