KEGG   Xenopus tropicalis (western clawed frog): 100492289Help
Entry
100492289         CDS       T01011                                 

Gene name
unc13a, munc13-1
Definition
(RefSeq) unc-13 homolog A
  KO
K15293  
protein unc-13 A/B/C
Organism
xtr  Xenopus tropicalis (western clawed frog)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Xenbase: 
Position
Un
AA seq 1741 aa AA seqDB search
MSLLCVGVKKATFDGAQEKFNAYVTLKVQNVKSTTIAVRGNQPCWEQDFMFEINRLDLGL
TVEVWNKGLIWDTMVGTVWIPLRTIRQSNEEGPGEWLTLDSQVIMTDNEICGTKDPTFHR
ILLDTRFELPLDIPEEEARYWAKKLEQLNAMRDQDDYVFQEEIPENPLPVHGSQCCNWNY
FGWGEQHNEDPDSAVDDRDSDYRSETSNSIPPPYYSTSQPNASVHQYPVRQQHSSHGSYT
DSVHSYEMDFSDHRPIRRYDSADSATNGRSDVESVSGSSRLTSRQHSLESRQSLDLSDSP
TGSSRYASSGEISRGSSQLSDDFDPDDDSLQGSEIEEERDRDSYHSCHSSVSCRKDSPNW
EGEEEREVYSEDEEEYPDSRGQLSDQELYDDDQLEEEEKKGRLAYGQEDSIYQSLEAEEK
EPLDIPLEKDRTPEAVPEEVVEPTVPAVQSPQAADSYREEEPGMSRAKSNWLRAFNKVRL
QLQEARGEGTGEMSKSLWFKDGPAGGLIIIDSMPDIRKRKPIPLVSDLAMSLVQSRKAGI
TSALATSTLNNEELKNHVYKKTLQALIYPISSTTPHNFEVWTATTPTYCYECEGLLWGIA
RQGMRCTECGVKCHEKCQDLLNADCLQRAAEKSSKHGAEDRTQNIIMVLKDRMKIRERNK
PEIFELIQEVFGVLKATHAQQIKAVKQSVLDGTSKWSAKISITVVCAQGLQAKDKTGSSD
PYVTVQVGKTKKRTKTIYGNLNPVWEENFHFECHNSSDRIKVRVWDEDDDIKSRVKQRFK
RESDDFLGQTIIEVRTLSGEMDVWYNLDKRTDKSAVSGAIRLHISVEIKGEEKVAPYHVQ
YTCLHENLFHYLTDVQNNGVVKIPDAKGDDAWKVYFDETAQEIVDEFAMRYGVESIYQAM
THFACLSSKYMCPGVPAVMSTLLANINAYYAHTTASTNVSASDRFSASNFGKERFVKLLD
QLHNSLRIDLSMYRNNFPASSPERLQDLKSTVDLLTSITFFRMKVQELQSPPRASQVVKD
CVKACLNSTYEYIFNNCHELYSREYQSDPAKKGEVPPEEQGPSIKNLDFWSKLITLIVSI
IEEDKNSYTPCLNQFPQELNVGKISAEVMWSLFAQDMRYAMEEHDKHRLCKSADYMNLHF
KVKWLYNEYVTELPSFKSKVPEYPAWFEPFVIQWLDENEEVSRDFLHGALERDKKDGFQQ
TSEHALFSCSVVDVFSQLNQSFEIIKKLECPDPQIVGHYMRRFAKTISNVLLQYAEIISK
DFASHCSKEKKEEKVPCILMNNIQQLRVQLEKMFEAMGGKELDAETSDILKELQVKLNNV
LDELSRVFTTSFQAQIEECVKQMGDILSQVKGTGNVPASNCSSVAQDADNVLQPILDPLD
SNLTLFAKICEKTVLKRVLKELWKLVMNTMEKTIVLPPLTDQTMIGTLLRKHGKGIEKSR
VKLPYHADGTHLIINAAKELGQLSKLKDHMVREEAKSLTPKQCAVVELALDTIKQYFHAG
GVGLKKTFLEKSPDLQSLRYALSLYTQATDTLIKTFVQTQSAQVHGGKGIRFTLNEETYP
EKGSGVDDSVGEVSIHVELFTHPGTGEHKISVKVVAANDLKWQTSGIFRPFIEVNMIGPN
LSDKKRKFTTKSKNNSWAPKYNESFQFTLGNETGPESYELQVCVKDYCFAREDRTVGMAV
MQLRDLAQRGSCACWLPLGRRIHMDETGLTILRILSQRNNDEVAKEFVKLKSDTRSPEEG
S
NT seq 5226 nt NT seq  +upstreamnt  +downstreamnt
atgtctttgctttgcgtgggagtaaaaaaggccacgtttgatggagcacaagagaagttt
aatgcctacgtaaccttgaaggtgcaaaatgtgaagagcacaacgatagcggtgcgggga
aaccagccctgctgggaacaggatttcatgtttgagattaatcgtttagaccttggtcta
acagtggaggtctggaacaaaggattgatctgggacaccatggtgggaacagtatggatt
cctttaaggacaatccgacaatccaatgaggagggtcctggggaatggctgacacttgat
tcacaggtcataatgacagataatgagatttgtggtaccaaagatccaaccttccaccgc
atcttactggatacccgatttgagcttcctctagatataccagaagaagaagctcgatac
tgggcaaagaaactcgagcaacttaatgcaatgagggaccaggatgattatgtttttcaa
gaagaaattccggagaatcctcttcctgtccatggatctcaatgttgtaactggaattat
ttcggctggggggagcagcacaatgaggatcccgatagtgcagtggatgatcgggatagt
gattaccgcagtgaaaccagcaacagtatcccgcccccctactactccacctcacagcct
aatgcctctgtgcaccagtaccctgtacgacagcaacacagttctcatggatcttacact
gattcagtgcacagctatgagatggacttctctgaccatcgtccaatcaggcgttacgat
agcgcagactctgccactaacgggcgcagtgatgtggagtctgtctccggttcgagccgc
ctcaccagccggcagcactctctggagagccggcagtccttagacctgtccgatagcccc
actggaagtagtcgatatgcttcatcaggggagattagtcgtggctcctcacagctcagt
gatgactttgacccagatgatgacagcttgcaaggttcagaaatagaggaagaaagggat
agagactcttatcactcctgtcatagttctgtcagctgccgcaaggactcgccaaattgg
gaaggagaggaggagcgtgaagtttatagtgaagatgaggaagaatatcctgacagtagg
gggcagctctctgaccaggagctgtatgatgatgaccagcttgaggaagaagagaaaaaa
ggaagattagcatatgggcaggaggattccatctatcagtcattggaggctgaggagaag
gaacccctggatattccattggagaaggacaggacaccagaagctgtgccagaggaggta
gtagagccaacagtaccagcagtccagtctccccaagctgcagacagttacagagaagaa
gaacctggaatgtccagggccaaatctaattggttaagagcattcaacaaggtgcgcctg
cagctgcaagaggcacgaggtgaagggactggggagatgtccaaatccctctggtttaag
gatgggccagctggtggtcttataattatagacagtatgccagacatacgaaagaggaaa
ccaatcccgttggtcagtgacctggcaatgtcactggttcagtcacggaaggctgggatt
acttctgctcttgcaacaagcaccttaaacaatgaagagctaaaaaaccatgtttacaaa
aagaccctgcaagctttaatatacccaatatccagcaccactccccacaactttgaagtt
tggactgccacaactcctacctattgttatgaatgcgaagggcttctgtggggaatcgct
cggcagggcatgcgttgcacagagtgtggtgtcaagtgccatgagaagtgccaggatctg
ctgaatgcagattgtcttcaaagagctgcagagaagagctcaaaacatggtgcagaagac
cggactcagaatattattatggtcttgaaggatcgtatgaagatccgggagaggaacaag
ccagaaatatttgagctgatccaggaagtatttggggtattaaaggctacacacgctcag
cagataaaggctgtgaaacagagtgtgctggatggtacttccaaatggtcagcaaagatc
agcataactgttgtatgtgcacagggtctacaggccaaagataagacaggctccagtgac
ccatatgttactgttcaagttgggaaaaccaagaaaagaaccaaaacaatctatggaaat
cttaatcctgtctgggaagagaattttcactttgaatgccacaactcctcagatcgtatt
aaagtacgcgtgtgggatgaagatgatgatatcaaatctcgtgtgaagcagagatttaaa
agagaatcagatgacttccttggacaaacaattattgaagtcagaacacttagcggagag
atggatgtgtggtataacttggataagagaacagataaatccgctgtctctggggcaatc
cgtcttcatataagtgtggaaataaaaggagaggaaaaggtggctccctatcacgtgcaa
tacacatgtctacatgagaacttattccattacctgacggatgtgcagaataatggtgtg
gtcaagattccagatgcaaaaggagacgacgcctggaaagtttattttgatgagacagcc
caggaaattgtggatgaatttgcaatgagatatggagtggagtccatataccaggccatg
acgcattttgcctgcctttcatctaaatatatgtgtccaggagtaccagctgtaatgagt
actcttcttgccaacattaatgcttactatgcgcacacaactgcatctactaatgtgtct
gcctccgaccgattctctgcctcaaactttgggaaggagagatttgtaaagctgcttgac
cagttgcacaattccttacgcattgacctgtccatgtatcggaacaacttccctgctagc
agccctgaaagactccaagatctcaagtccactgtagatttactaactagcataacattt
ttccggatgaaggtacaagagcttcagagcccaccacgggcaagccaagttgttaaggac
tgtgtgaaggcatgccttaactcaacctacgaatatatctttaacaactgccatgaactt
tatagccgagaatatcaaagtgaccctgctaaaaaaggggaggtacccccagaagaacag
gggccaagtataaagaacttagatttttggtccaaactaatcacattgattgtgtctatc
atagaggaagataagaactcatatacaccttgtctaaaccagtttcctcaggagctaaat
gttggtaagattagtgctgaggtcatgtggagtctctttgctcaagacatgagatatgct
atggaagaacacgacaaacaccgcctgtgtaagagtgcagactacatgaacttgcatttt
aaggtcaagtggttgtacaatgaatatgtaactgagctaccatcttttaagagcaaggtt
ccagaatatcccgcctggtttgagccttttgtaattcagtggctggatgaaaatgaagag
gtctcccgggattttctgcatggagcacttgaaagagataagaaggatgggttccagcag
acctctgaacatgccctgttctcctgctctgtggtagatgttttctcacaacttaaccag
agctttgagatcattaagaagttggagtgtccagacccacaaattgtggggcattacatg
cgtagatttgccaagacgatcagtaatgttctgctgcagtatgctgaaattatttccaaa
gattttgcatctcattgctccaaagagaagaaagaagaaaaagtgccctgtattcttatg
aacaatatccagcaacttcgagtgcaactagaaaaaatgtttgaagcaatgggaggaaag
gagctggatgcagaaacaagtgacattcttaaagagctgcaggtgaaactcaacaatgtc
ctagatgagctaagcagagtgtttaccaccagttttcaggcacaaattgaggagtgtgtg
aagcagatgggtgacattctgagccaggtaaaagggaccggaaatgtaccagccagtaac
tgcagcagtgtggctcaggatgcagataatgtattgcagcctatcctggatcctctggac
agcaacctgacactatttgccaagatctgtgaaaagacagtcctgaagcgggtactaaaa
gaactctggaagcttgtgatgaatacaatggagaaaacgattgtccttccaccactaaca
gaccaaacaatgatagggacgctgctgagaaaacatggcaagggaatagagaagagcagg
gtgaagctgccgtaccacgcagatggaacccaccttatcattaatgcagccaaggaactg
ggccagttatccaaactaaaggatcacatggtgcgagaggaagccaagagcctcacccct
aagcagtgtgcagtggtggagcttgcacttgatacaattaagcaatatttccatgctgga
ggtgttggtctcaagaagacattcctggagaagagtccagacctacaatctctacgctat
gcactttctctttacacacaagcaaccgatacgctaatcaaaaccttcgtccagacacag
tctgctcaggttcatggtggtaaaggtattaggtttacacttaatgaagagacttatcca
gaaaagggatctggggtggatgattctgttggggaagtttctatccatgtggagttattt
actcacccaggaacaggcgagcacaagatcagcgtaaaggttgtagcggccaatgacctt
aaatggcagacgtcagggattttccgtccctttattgaggtaaacatgattggtccgaat
ctgagtgacaaaaaaaggaaatttaccaccaagtccaagaacaacagctgggccccaaaa
tataacgagagcttccaatttaccctgggtaatgagactggtccagagagttatgagctg
caagtatgtgtgaaagattactgttttgctcgggaagaccgcacagtgggaatggctgtc
atgcaactgcgagatctggcacaaaggggtagctgtgcctgttggctccctcttggccgc
cgcattcatatggatgagacaggactgaccatcttgcgcatactatcacaaagaaacaat
gatgaggtggccaaagagtttgtcaaactcaaatctgacacccgctctccagaagagggg
agctag

DBGET integrated database retrieval system