KEGG   Xenopus tropicalis (western clawed frog): 100493532Help
Entry
100493532         CDS       T01011                                 

Gene name
ezh1
Definition
enhancer of zeste homolog 1 (Drosophila)
Orthology
K17451  
histone-lysine N-methyltransferase EZH1 [EC:2.1.1.43]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
Enzymes [BR:xtr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100493532 (ezh1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 748 aa AA seqDB search
MRSVTPKDCSTVLHSPMEPPDPTYTRTLMCWKKRVRSEYIRLQQLKRFQANTAARMFYVE
NLTKAQERAHLLNEDWKKLRVQPIQMMKPTSGHPFLKKSTVESSFPGFAVQTIFMRSLNT
VALVPIMYSWSPLQQNFMVEDETVLCNIPYMGDEVKEEDETFIEELINNYDGKVHGEEGS
GLLDDASFLELMEALLQYTDEEEKWLSYSTEGKGEEVKEEGPMTRKRKRIAEEGSKRVCR
SLLPNDLIFSAISAVFPERGFPEEVKKRYKELTEAYDPNALPPQCTPNIDGPCAKSVQRE
QSLHSFHTLFCRRCFKYDCFLHPFHASPNVYKRRNREIKIETEPCGIHCFLWLEGAKEYA
MMNNPRSKCLGRRRRKTTALAASGSNSNVMETKEGDSDRDTGNDCASSSSEANSRSQTPT
KQRQGSLSGELPDVSEPSEPVEWSGAEESLFRVFHGTYFNNFCSIARLMGTKTCKQVFQF
AVTDSLLLKVPAKELMSTAQKKKRKHRFCLVSDNSANQVYNYQPCDHPDHPCDSTCPCIM
TQNFCEKFCQCNPDCQNRFPGCRCKTQCNTKQCPCYLAVRECDPDLCLTCGASEHWDSKV
VSCKNCSIQRGLKKHLLLAPSDVAGWGTFIKESVQKNEFISEYCGELISQDEADRRGKVY
DKYMSSFLFNLNNDFVVDATRKGNKIRFANHSVHPNCYAKVVMVNGDHRIGIFAKRTIQA
GEELFFDYRYSQADALKYVGIERETDIM
NT seq 2247 nt NT seq  +upstreamnt  +downstreamnt
atgcgatctgtcacccccaaggattgctctactgtcctacacagcccaatggagcctcca
gacccaacatacacaagaacattgatgtgctggaagaagagagtgcgttcagaatacata
cggctgcagcaactaaaacgttttcaggccaatacagcggctaggatgttttacgtagaa
aacctgacaaaggcacaagaaagggcacaccttttaaatgaagattggaagaaattaagg
gtgcagcccattcagatgatgaaacctacaagtggccacccattcttgaaaaagtccaca
gtggaaagcagcttcccaggttttgctgtccagaccatatttatgagatccctgaacact
gtggctttagtgcccatcatgtattcatggtcacctctgcaacagaatttcatggtggaa
gatgagactgttttgtgtaatattccttacatgggcgatgaggtcaaggaagaggatgag
acctttattgaggaactgatcaataattatgatggcaaagtgcatggagaagaaggttct
ggtctactggatgatgcttctttcttagagcttatggaagcccttcttcaatataccgat
gaagaggagaaatggcttagttattctactgaaggaaagggggaggaggtaaaggaagag
ggtcccatgaccaggaagaggaaacgcattgctgaggaaggtagcaagagagtctgtagg
agccttctgccaaatgacttgatcttcagtgcaatatcagctgtgtttccagagagaggc
tttccagaagaagtgaaaaaacggtacaaagaactgacagaagcctatgatcccaatgca
ttgcctccccagtgtactcctaacattgatggaccatgtgccaaatctgtgcaaagggag
cagtctcttcactccttccacaccctcttctgtcgccgctgttttaagtatgactgcttt
ctacacccattccacgcaagtcctaatgtatacaagagaaggaatcgagaaataaagatt
gaaactgagccctgtggaattcattgcttcttgtggctggaaggagcaaaagaatatgct
atgatgaacaatcccagatccaaatgcttgggaaggcgtcgccggaaaaccacagccctt
gctgcctctggctcaaactctaatgtaatggagactaaagagggggacagtgatcgagac
actggcaatgactgtgcttctagctcttcagaagcaaattcacggagccaaacccctacc
aaacaaaggcagggaagcctaagtggggagcttccagatgtgtctgaacccagtgagcca
gtggaatggtctggagctgaggagtcactctttagggtcttccatggaacttacttcaac
aatttctgttccattgctcgtctaatgggcaccaagacatgcaagcaggttttccagttt
gctgtgacagattccttgctcttaaaagtgccagcaaaggaactaatgagcactgcacaa
aaaaagaaacggaagcacagattctgcctcgtatcagataattctgcaaaccaagtgtac
aattaccagccttgtgaccacccggatcacccatgtgacagcacgtgtccctgcattatg
actcagaacttctgtgaaaagttctgccagtgcaacccagattgtcagaaccgctttcca
ggatgccgatgcaaaacccagtgtaacaccaagcagtgtccatgttacctcgctgtacga
gaatgtgatccagatctgtgtctgacatgtggagcatccgaacactgggattctaaggtg
gtgtcctgcaaaaactgtagcatccagagaggactgaaaaagcatttgctgttagcaccg
tctgatgttgctgggtgggggaccttcattaaagagtctgtccagaagaatgaattcatc
tcggaatactgcggtgagctgatctctcaagacgaagcagatcgaagaggaaaagtttat
gacaaatatatgtccagttttctctttaacctcaacaatgattttgttgttgatgctaca
cgtaaaggaaacaaaatcagatttgcaaatcactctgttcatcccaattgttatgcaaaa
gtggtaatggtgaatggagaccatcggattggaatctttgctaaaagaaccatacaagca
ggagaagaattgttctttgattacagatacagccaagctgatgccctgaaatatgttggt
attgaacgagagactgacattatgtaa

DBGET integrated database retrieval system