KEGG   Xenopus tropicalis (western clawed frog): 100493532Help
Entry
100493532         CDS       T01011                                 

Gene name
ezh1
Definition
(RefSeq) enhancer of zeste 1 polycomb repressive complex 2 subunit
  KO
K17451  
histone-lysine N-methyltransferase EZH1 [EC:2.1.1.43]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100493532 (ezh1)
Enzymes [BR:xtr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100493532 (ezh1)
Chromosome [BR:xtr03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100493532 (ezh1)
   Polycomb group proteins
    PRC2-EZH1 complex
     100493532 (ezh1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Xenbase: 
Position
Un
AA seq 790 aa AA seqDB search
MRSVTPKDCSTVLHSPMEPPDPTYTRTLMCWKKRVRSEYIRLQQLKRFQANTAARMFYVE
NLTKAQERAHLLNEDWKKLRVQPIQMMKPTSGHPFLKKSTVESSFPGFAVQTIFMRSLNT
VALVPIMYSWSPLQQNFMVEDETVLCNIPYMGDEVKEEDETFIEELINNYDGKVHGEEEL
DLKSTMLSSPRLHDRERLFRFGQSFSSGRNSTIKTGSGLLDDASFLELMEALLQYTDEEE
KWLSYSTEGKGEEVKEEGPMTRKRKRIAEEGSKRVCRSLLPNDLIFSAISAVFPERGFPE
EVKKRYKELTEAYDPNALPPQCTPNIDGPCAKSVQREQSLHSFHTLFCRRCFKYDCFLHP
FHASPNVYKRRNREIKIETEPCGIHCFLWLEGAKEYAMMNNPRSKCLGRRRRKTTALAAS
GSNSNVMETKEGDSDRDTGNDCASSSSEANSRSQTPTKQRQGSLSGELPDVSEPSEPVEW
SGAEESLFRVFHGTYFNNFCSIARLMGTKTCKQVFQFAVTDSLLLKVPAKELMSTAQKKK
RKHRYMLNSFCLVSDNSANQVYNYQPCDHPDHPCDSTCPCIMTQNFCEKFCQCNPDCQNR
FPGCRCKTQCNTKQCPCYLAVRECDPDLCLTCGASEHWDSKVVSCKNCSIQRGLKKHLLL
APSDVAGWGTFIKESVQKNEFISEYCGELISQDEADRRGKVYDKYMSSFLFNLNNDFVVD
ATRKGNKIRFANHSVHPNCYAKVVMVNGDHRIGIFAKRTIQAGEELFFDYRYSQADALKY
VGIERETDIM
NT seq 2373 nt NT seq  +upstreamnt  +downstreamnt
atgcgatctgtcacccccaaggattgctctactgtcctacacagcccaatggagcctcca
gacccaacatacacaagaacattgatgtgctggaagaagagagtgcgttcagaatacata
cggctgcagcaactaaaacgttttcaggccaatacagcggctaggatgttttacgtagaa
aacctgacaaaggcacaagaaagggcacaccttttaaatgaagattggaagaaattaagg
gtgcagcccattcagatgatgaaacctacaagtggccacccattcttgaaaaagtccaca
gtggaaagcagcttcccaggttttgctgtccagaccatatttatgagatccctgaacact
gtggctttagtgcccatcatgtattcatggtcacctctgcaacagaatttcatggtggaa
gatgagactgttttgtgtaatattccttacatgggcgatgaggtcaaggaagaggatgag
acctttattgaggaactgatcaataattatgatggcaaagtgcatggagaagaagaatta
gacttgaaatcaaccatgttatcaagtcctcgattacatgaccgtgagcggttattcagg
tttgggcagtccttctcctctggacgaaacagtaccattaaaacaggttctggtctactg
gatgatgcttctttcttagagcttatggaagcccttcttcaatataccgatgaagaggag
aaatggcttagttattctactgaaggaaagggggaggaggtaaaggaagagggtcccatg
accaggaagaggaaacgcattgctgaggaaggtagcaagagagtctgtaggagccttctg
ccaaatgacttgatcttcagtgcaatatcagctgtgtttccagagagaggctttccagaa
gaagtgaaaaaacggtacaaagaactgacagaagcctatgatcccaatgcattgcctccc
cagtgtactcctaacattgatggaccatgtgccaaatctgtgcaaagggagcagtctctt
cactccttccacaccctcttctgtcgccgctgttttaagtatgactgctttctacaccca
ttccacgcaagtcctaatgtatacaagagaaggaatcgagaaataaagattgaaactgag
ccctgtggaattcattgcttcttgtggctggaaggagcaaaagaatatgctatgatgaac
aatcccagatccaaatgcttgggaaggcgtcgccggaaaaccacagcccttgctgcctct
ggctcaaactctaatgtaatggagactaaagagggggacagtgatcgagacactggcaat
gactgtgcttctagctcttcagaagcaaattcacggagccaaacccctaccaaacaaagg
cagggaagcctaagtggggagcttccagatgtgtctgaacccagtgagccagtggaatgg
tctggagctgaggagtcactctttagggtcttccatggaacttacttcaacaatttctgt
tccattgctcgtctaatgggcaccaagacatgcaagcaggttttccagtttgctgtgaca
gattccttgctcttaaaagtgccagcaaaggaactaatgagcactgcacaaaaaaagaaa
cggaagcacaggtacatgttgaactcattctgcctcgtatcagataattctgcaaaccaa
gtgtacaattaccagccttgtgaccacccggatcacccatgtgacagcacgtgtccctgc
attatgactcagaacttctgtgaaaagttctgccagtgcaacccagattgtcagaaccgc
tttccaggatgccgatgcaaaacccagtgtaacaccaagcagtgtccatgttacctcgct
gtacgagaatgtgatccagatctgtgtctgacatgtggagcatccgaacactgggattct
aaggtggtgtcctgcaaaaactgtagcatccagagaggactgaaaaagcatttgctgtta
gcaccgtctgatgttgctgggtgggggaccttcattaaagagtctgtccagaagaatgaa
ttcatctcggaatactgcggtgagctgatctctcaagacgaagcagatcgaagaggaaaa
gtttatgacaaatatatgtccagttttctctttaacctcaacaatgattttgttgttgat
gctacacgtaaaggaaacaaaatcagatttgcaaatcactctgttcatcccaattgttat
gcaaaagtggtaatggtgaatggagaccatcggattggaatctttgctaaaagaaccata
caagcaggagaagaattgttctttgattacagatacagccaagctgatgccctgaaatat
gttggtattgaacgagagactgacattatgtaa

DBGET integrated database retrieval system