KEGG   Xenopus tropicalis (western clawed frog): 448152Help
Entry
448152            CDS       T01011                                 

Gene name
chp1, chp
Definition
(RefSeq) calcineurin-like EF-hand protein 1
  KO
K17610  calcineurin B homologous protein 1
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
Protein phosphatases and associated proteins [BR:xtr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     448152 (chp1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_6 EF-hand_7 EF-hand_5 EF-hand_8 SPARC_Ca_bdg RST HTH_23
Motif
Other DBs
NCBI-GeneID: 448152
NCBI-ProteinID: NP_001004859
Xenbase: XB-GENE-1007598
UniProt: Q6DK70
Position
8
AA seq 193 aa AA seqDB search
MGSRASTLLRDEEIEEIKKETGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAIN
PLGDRIINAFFTEGEDQVNFRGFMRTLAHFRPIEDNSKDANSQEPLNSRSNKLLFAFRLY
DLDKDDKISREELLQVLRMMVGVNISDDQLGSIADRTIQEADQDGDSAISFTEFVKVLEK
VDVEQKMSIRFLH
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgggctccagggcgtcaactttgctcagggatgaggagatagaagagataaagaaagag
acgggtttttctcacagccagataactcgattgtatagtcggttcacaagcctggataaa
ggagaaaatgggactttaagtcgagaagatttccagcggataccagagttggctatcaac
cctcttggagatagaattatcaatgctttcttcactgaaggagaggaccaagtgaatttc
cgaggcttcatgaggactttggcacacttccgcccaattgaagataattcaaaagatgca
aacagtcaagagccactgaatagcagaagcaacaaattgttatttgcgtttcgtctctat
gacttggacaaagatgacaagatctctagggaggagctattacaggtcctgcgcatgatg
gtgggggtgaacatatcagatgatcagctgggtagcatcgctgaccgcactatacaggaa
gctgaccaagatggagacagtgccatatcattcacagagtttgttaaggttttagaaaaa
gttgatgtagaacagaaaatgagcatccgtttcctacattga

DBGET integrated database retrieval system