KEGG   Xenopus tropicalis (western clawed frog): 493520Help
Entry
493520            CDS       T01011                                 

Gene name
dyrk3
Definition
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 3
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 567 aa AA seqDB search
MLLTRKPEGPIAAVRYGDGLYDSYMRLDQMAAQDAAEDKESPSTLPSFGRLTISGNKLAM
KDQQQVKVQQLFEDSGNRRVGAGVTSTESAFPLLTKEKSSDGSGTSKSSDSSAKSSKATY
LTPDQAVKQYKHQLSAYELQEISSFSEIYFVGPNAKKRQGVVGGPNNGGYDDDQGGYNLV
PHDHVAYRYEVLKVIGKGSFGQVAKVYDHKLHQHLALKMVRNEKRFHRQAAEEIRILEHL
KKQDKTGSMNVIHMLESFTFRNHICMTFELLSMNLYELIKRNKFQGFSLQLVRKFAHSIL
QCLEALYRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSCFDHQRVYTYIQSRFYRAPEV
ILGSRYGMPIDMWSFGCILVELLTGYPLFPGEDEGDQLACMMELLGAPPPKLLEQAKRAK
NFINSKGYPRYCTVTTLPNGTTVLNGSRSRRGKMRGAPGSKDWVAALKGCEDSLFIDFLK
GCLTWDPVARMTPSQALRHQWISKRLPKPSVTEKASGKRISSQTSSFPGIGSKLPPVVGV
ANKLRANLMNDSNGSIPLRTVLPKLVS
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgctcctgacaaggaagcctgagggccccatagcagcagtgcgatatggtgatggcttg
tatgattcatatatgaggcttgatcagatggcagcacaagatgcggcagaggataaagaa
agcccctccactctaccttcatttgggagactaactataagtggaaataaacttgcaatg
aaggatcaacaacaagttaaagtgcaacagttatttgaagactccggtaaccgaagggtt
ggtgcaggtgttacaagtactgaaagtgcatttcccttgctgacaaaagaaaaaagttca
gacggctcaggaacttcaaaatctagtgatagctctgccaagtcatcaaaggccacatac
ctgactcctgaccaagcagtgaagcaatacaagcaccagctctctgcttatgagctacaa
gaaattagtagtttttctgagatatattttgtgggtccaaatgcaaagaagaggcaagga
gttgtagggggtcctaataatggaggctatgatgatgatcaaggaggctacaatttagtg
ccacatgaccacgtggcataccgatatgaagttcttaaggttattgggaaaggcagtttt
ggtcaggttgcaaaagtttatgaccacaagcttcaccagcatttggcactaaagatggtc
cgcaatgaaaagagatttcaccggcaggctgcagaagagatccgcatcctggaacacctc
aagaaacaggacaagactggtagtatgaatgtgatacacatgctggagagtttcactttc
cgaaaccacatttgtatgacatttgagcttctcagcatgaatttatatgagctaattaaa
cgaaataagtttcaaggttttagtctgcaacttgttcgcaaatttgcccattcaatcctt
cagtgcttggaagctttatacaggaataagatcatccactgtgacttgaaacctgaaaat
attctcctcaaacagcaagggcgtagtggtattaaagtgatagattttgggtccagttgc
ttcgatcaccaaagagtctacacatacatacagtcccgtttctacagagcacccgaggtc
attctgggaagccgttatggtatgcccattgatatgtggagttttggctgcatattggtt
gagctcctaacaggttatccattgttcccaggtgaggatgagggagaccaactagcatgt
atgatggagcttcttggtgcaccacctccaaagcttctagaacaagccaaaagagcaaag
aactttattaactccaagggatacccacgatactgtactgtcaccactcttcctaatggg
acaacagttctcaatggcagcaggtcgcgcagaggtaaaatgcgtggtgcacctggcagc
aaagactgggtggcagctttgaagggttgtgaagactcccttttcattgattttttaaag
ggttgtctcacctgggacccagttgcacgtatgacccctagccaggccctgcggcatcag
tggatttccaagagactgcctaagccttcagtaaccgagaaggcttcaggtaaaagaatt
tccagccaaaccagctcttttccaggcattggctccaaactgcctccagtcgtaggtgtg
gctaacaaattacgggccaatttaatgaatgactccaatggaagcataccacttcgaact
gttttacctaagctagtcagctga

DBGET integrated database retrieval system