KEGG   Yersinia enterocolitica subsp. enterocolitica 8081: YE0562Help
Entry
YE0562            CDS       T00469                                 

Gene name
b4372
Definition
(RefSeq) DNA polymerase III subunit psi
  KO
K02344  DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
yen  Yersinia enterocolitica subsp. enterocolitica 8081
Pathway
yen00230  Purine metabolism
yen00240  Pyrimidine metabolism
yen01100  Metabolic pathways
yen03030  DNA replication
yen03430  Mismatch repair
yen03440  Homologous recombination
Module
yen_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:yen00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    YE0562 (b4372)
   00240 Pyrimidine metabolism
    YE0562 (b4372)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    YE0562 (b4372)
   03430 Mismatch repair
    YE0562 (b4372)
   03440 Homologous recombination
    YE0562 (b4372)
Enzymes [BR:yen01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     YE0562 (b4372)
DNA replication proteins [BR:yen03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     YE0562 (b4372)
DNA repair and recombination proteins [BR:yen03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     YE0562 (b4372)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_III_psi CSTF_C
Motif
Other DBs
NCBI-GeneID: 4713402
NCBI-ProteinID: YP_001008368
UniProt: A1JJ90
Position
647457..647894
Genome map
AA seq 145 aa AA seqDB search
MASRRDLLLQQLGITQWTLRRPAVLQGEIAIRLPDDTRLLIVADPLPEQDDPLLCDVLRC
LGLNPHQAYALTPDQVAMLPEETQCNSWRLGISEPLAVAGAQLYSPALTGLYQDASAKRA
LWQQICHHEADFYPDASRSGHSVPN
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atggcatcaagacgagacttactgttacaacagctgggtattacgcagtggacattgcgc
cgcccggccgttttgcaaggtgaaattgccatacgtttacccgacgatacccgcctgtta
attgtcgcagacccgcttcctgagcaggatgacccgttgttgtgtgatgtgttgcgctgc
cttgggctaaatccgcatcaggcctatgcgctgacgccggatcaggtggcaatgttaccc
gaagagacacagtgcaacagttggcgattgggcatcagtgaaccgcttgcggttgcgggt
gcgcagttatacagcccggccctgaccggactttatcaagacgcgagcgctaagcgcgca
ctttggcagcagatttgtcatcatgaagcagatttctatcctgacgccagccgatctggc
cacagcgtaccaaattga

DBGET integrated database retrieval system