KEGG   Yersinia enterocolitica subsp. enterocolitica 8081: YE0562Help
Entry
YE0562            CDS       T00469                                 

Gene name
b4372
Definition
DNA polymerase III subunit psi
Orthology
K02344  
DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
yen  Yersinia enterocolitica subsp. enterocolitica 8081
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:yen00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    YE0562 (b4372)
   00240 Pyrimidine metabolism
    YE0562 (b4372)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    YE0562 (b4372)
   03430 Mismatch repair
    YE0562 (b4372)
   03440 Homologous recombination
    YE0562 (b4372)
Enzymes [BR:yen01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     YE0562 (b4372)
DNA replication proteins [BR:yen03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     YE0562 (b4372)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
647457..647894
Genome map
AA seq 145 aa AA seqDB search
MASRRDLLLQQLGITQWTLRRPAVLQGEIAIRLPDDTRLLIVADPLPEQDDPLLCDVLRC
LGLNPHQAYALTPDQVAMLPEETQCNSWRLGISEPLAVAGAQLYSPALTGLYQDASAKRA
LWQQICHHEADFYPDASRSGHSVPN
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atggcatcaagacgagacttactgttacaacagctgggtattacgcagtggacattgcgc
cgcccggccgttttgcaaggtgaaattgccatacgtttacccgacgatacccgcctgtta
attgtcgcagacccgcttcctgagcaggatgacccgttgttgtgtgatgtgttgcgctgc
cttgggctaaatccgcatcaggcctatgcgctgacgccggatcaggtggcaatgttaccc
gaagagacacagtgcaacagttggcgattgggcatcagtgaaccgcttgcggttgcgggt
gcgcagttatacagcccggccctgaccggactttatcaagacgcgagcgctaagcgcgca
ctttggcagcagatttgtcatcatgaagcagatttctatcctgacgccagccgatctggc
cacagcgtaccaaattga

DBGET integrated database retrieval system